Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL152C (YGL152C)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Gene locus: YGL152C is located on chromosome VII of Saccharomyces cerevisiae (strain S288c) and encodes a 225-amino acid protein (UniProt ID: P53113) . The open reading frame (ORF) has been annotated as "dubious" in some studies due to overlaps with neighboring genes such as PEX14 and PEX2, which are critical for peroxisomal function .

Protein features:

  • Molecular weight: ~25 kDa (calculated) .

  • Isoelectric point: Data not experimentally determined.

  • Sequence: Contains hydrophobic regions and transmembrane helices predicted via computational analysis .

Recombinant Production

Recombinant YGL152C is produced in E. coli systems with His-tags for purification. Key product specifications:

ParameterDetailsSource
Expression hostE. coli
Purity>90% (SDS-PAGE)
StorageTris buffer with 50% glycerol; stable at -20°C/-80°C

Challenges and Controversies

  • Dubious ORF status: YGL152C’s annotation as a non-functional ORF complicates functional studies. Observed peroxisomal defects in deletion strains may result from overlapping genes (PEX14, PEX2) rather than YGL152C itself .

  • Lack of pathway data: No confirmed involvement in metabolic or signaling pathways despite commercial claims .

Future Directions

  • Functional studies: CRISPR-based knockout models to isolate YGL152C’s role independently of adjacent genes.

  • Structural biology: X-ray crystallography or cryo-EM to resolve its 3D structure and identify binding partners.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development to meet your requirements.
Synonyms
YGL152C; G1873; Putative uncharacterized protein YGL152C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGL152C
Target Protein Sequence
MSIVSRTVTITISVKKLITYIELRYGMESSTCPFCQSGTLISLAAVFFCHSGMEALLSIV CSLAFFHAGTALSSLLASLPFSFSLSLSSCMPILARISDADGIVSMPGIPLGDMENNLLS CALPDSIRLFIKLFRDSISFWILFNSCMPSLSETNLSIVFCILTTSSLTILNSSSIFSLL LVVCTSACFSSAIVSLSSFNVSLSFFLNSACSASMALRTVSILEN
Uniprot No.

Target Background

Database Links

STRING: 4932.YGL152C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of YGL152C in Saccharomyces cerevisiae?

YGL152C is a putative uncharacterized protein encoded in the Saccharomyces cerevisiae genome. The gene is located on chromosome VII with an expression region spanning amino acids 1-225 . It belongs to the class of open reading frames (ORFs) that have been identified through computational gene prediction methods but have yet to be fully characterized functionally. The genomic context includes adjacent genes and regulatory elements that may provide clues to its function. As with many yeast genes, its identification stems from systematic genome analysis projects that have mapped the complete S. cerevisiae genome, recognized as one of the first eukaryotic genomes to be fully sequenced and annotated .

What are the known structural features of the YGL152C protein?

The YGL152C protein consists of 225 amino acids with the following sequence: MSIVSRTVTITISVKKLITYIELRYGMESSTCPFCQSGTLISLAAVFFCHSGMEALLSIVCSLAFFHAGTALSSLLASLPFSFSLSLSSCMPILARISDADGIVSMPGIPLGDMENNLLSCALPDSIRLFIKLFRDSISFWILFNSCMPSLSETNLSIVFCILTTSSLTILNSSSIFSLLVVCTSACFSSAIVSLSSFNVSLSFFLNSACSASMALRTVSILEN . Structural analysis suggests the protein may contain transmembrane domains, based on the presence of hydrophobic amino acid stretches. The protein sequence contains a CPFC motif, which could potentially function as a redox-active site. Secondary structure prediction algorithms indicate a mix of alpha-helical and beta-sheet regions, though no crystal structure has been determined to date. Bioinformatic analysis using algorithms like those based on the Z-curve method might provide additional insights into its coding potential and structural features .

How is recombinant YGL152C typically expressed and purified for research applications?

Recombinant YGL152C is typically expressed using standard yeast expression systems optimized for S. cerevisiae proteins. The recommended protocol involves:

  • Cloning the YGL152C coding sequence into an appropriate yeast expression vector with a selectable marker

  • Transforming the construct into a suitable S. cerevisiae strain (often S288c derivatives)

  • Inducing expression under optimal conditions (temperature, media composition, induction time)

  • Cell lysis using mechanical disruption methods (bead-beating or French press)

  • Purification via affinity chromatography if expressed with a tag (His, GST, or other)

  • Storage in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term preservation

For experimental applications, it's crucial to avoid repeated freeze-thaw cycles, with recommendation to store working aliquots at 4°C for up to one week . Typical yields range from 1-5 mg/L of culture, depending on the expression system and optimization conditions.

What methods are most effective for studying the potential function of uncharacterized proteins like YGL152C?

Investigating uncharacterized proteins like YGL152C requires a multi-faceted approach:

  • Comparative genomics: Identify potential homologs in other species that may have known functions, using tools like BLAST and protein family databases.

  • Gene deletion/mutation analysis: Create knockout or point mutation strains using CRISPR-Cas9 or traditional homologous recombination methods to observe phenotypic changes.

  • Protein-protein interaction studies: Use techniques such as yeast two-hybrid screening, co-immunoprecipitation, or proximity labeling to identify interacting partners.

  • Transcriptomics analysis: Examine gene expression changes under various conditions using RNA-seq to identify potential co-regulated genes.

  • Subcellular localization: Use GFP-tagging or immunofluorescence to determine where YGL152C localizes within the cell.

The approach has proven particularly valuable in yeast models, where the highly conserved proteome across eukaryotes allows findings to be translated to higher organisms . For YGL152C specifically, its potential membrane association (based on sequence analysis) suggests that techniques optimized for membrane proteins may yield more informative results.

How can researchers determine if YGL152C is a true protein-coding gene rather than a pseudogene?

Determining whether YGL152C represents a genuine protein-coding gene requires multiple lines of evidence:

  • Computational analysis using Z-curve methodology: Calculate the YZ score for YGL152C. A score above 0.5 strongly suggests it is a true protein-coding gene, while scores below 0.5 suggest a non-coding sequence .

  • Transcriptional evidence: Confirm active transcription through RNA-seq or RT-PCR under various growth conditions.

  • Translational evidence: Use ribosome profiling (Ribo-seq) to verify that the mRNA is actively translated.

  • Proteomics validation: Detect the protein product through mass spectrometry analyses of yeast cell extracts.

  • Conservation analysis: Examine evolutionary conservation patterns that typically differ between coding and non-coding sequences.

The Z-curve methodology has demonstrated >95% accuracy in recognizing protein-coding genes in the yeast genome and provides a reliable metric for distinguishing true genes from spurious ORFs . For YGL152C, integrating these approaches can provide a confidence assessment regarding its status as a bona fide protein-coding gene.

What are the optimal conditions for studying YGL152C protein expression in vivo?

Optimizing conditions for studying YGL152C expression in vivo requires careful consideration of several factors:

ParameterRecommended ConditionRationale
Growth mediaYPD for standard growth; Synthetic defined media for controlled experimentsAllows for both rich and selective growth environments
Temperature30°C standard; Test 25°C and 37°C for stress responseTemperature affects protein folding and expression levels
Growth phaseLog phase for active expression; Stationary phase for stress responseExpression patterns may vary with cell cycle and growth phase
Carbon sourceGlucose (2%) standard; Test galactose or glycerol for alternative regulationDifferent carbon sources can activate alternative metabolic pathways
Stress conditionsOsmotic, oxidative, or nutrient stressMay induce expression if YGL152C responds to specific stressors

When monitoring expression, it's recommended to use both transcriptomic (qPCR, RNA-seq) and proteomic (Western blot, mass spectrometry) approaches in parallel, as post-transcriptional regulation may significantly impact protein levels. For certain experimental designs, particularly those involving galactose or glycerol/lactate as carbon sources, transcriptional responses may be more pronounced, as has been observed with other yeast genes .

How can YGL152C be utilized in synthetic biology applications?

YGL152C can be integrated into synthetic biology frameworks through several innovative approaches:

  • Biosensor development: If YGL152C responds to specific environmental conditions, it could be coupled with reporter genes to create biosensors for those conditions.

  • Orthogonal protein scaffolds: The protein's structure might serve as a novel scaffold for engineering protein-protein interactions or enzyme cascades.

  • Minimal genome projects: As an uncharacterized protein, understanding YGL152C's dispensability would contribute to defining the minimal yeast genome.

  • Heterologous expression systems: YGL152C could be incorporated into designer yeast strains optimized for specific biotechnological applications.

  • Protein engineering platforms: Using directed evolution, YGL152C could potentially be evolved for novel functions.

The development of whole, recombinant S. cerevisiae yeast systems has already demonstrated success in applications such as immunotherapy, where yeast expressing specific target proteins stimulated immune responses . Similar approaches could be applied to YGL152C once its function is better understood, potentially leveraging the protein for biotechnological or biomedical applications.

What techniques can be employed to study potential RNA-protein interactions involving YGL152C?

Investigating potential RNA-protein interactions involving YGL152C requires specialized techniques:

  • RNA immunoprecipitation (RIP): Using antibodies against tagged YGL152C to isolate bound RNA molecules, followed by sequencing or RT-PCR.

  • Cross-linking and immunoprecipitation (CLIP): Employing UV cross-linking to capture transient RNA-protein interactions before immunoprecipitation.

  • Electrophoretic mobility shift assay (EMSA): Detecting direct interactions between purified YGL152C and candidate RNA molecules.

  • Yeast three-hybrid system: Screening for RNA-protein interactions in vivo using a modified yeast two-hybrid approach.

  • Structure determination: Using techniques like NMR spectroscopy or X-ray crystallography to visualize RNA-protein complexes at atomic resolution.

S. cerevisiae has proven exceptionally valuable as a research tool for RNA-mediated processes, with applications ranging from studying RNA-binding proteins involved in amyotrophic lateral sclerosis to investigating translation regulation in cancer . If YGL152C does interact with RNA, these established methodologies can be readily applied to characterize the nature and specificity of such interactions.

How might YGL152C function be related to broader cellular processes in yeast?

The potential function of YGL152C can be contextualized within broader cellular processes through integrative approaches:

  • Systems biology analysis: Integrating transcriptomic, proteomic, and metabolomic data to position YGL152C within cellular networks.

  • Genetic interaction mapping: Performing systematic genetic interaction screens (e.g., synthetic genetic array analysis) to identify functional relationships with known pathways.

  • Condition-specific essentiality: Testing whether YGL152C becomes essential under specific stress conditions or genetic backgrounds.

  • Evolutionary analysis: Examining the conservation and divergence patterns of YGL152C across fungal species to infer functional constraints.

  • Cellular compartment-specific analysis: Investigating how YGL152C might function within specific organelles or cellular structures based on localization data.

The presence of a CPFC motif in its amino acid sequence suggests potential involvement in redox processes, while the hydrophobic regions might indicate membrane association . Understanding these structural features in relation to cellular compartmentalization could provide insights into YGL152C's role in processes such as protein trafficking, membrane dynamics, or cellular stress responses.

What bioinformatic approaches are most valuable for predicting YGL152C function?

Effective bioinformatic prediction of YGL152C function combines multiple computational strategies:

  • Sequence homology analysis: Beyond basic BLAST searches, employ position-specific scoring matrices and hidden Markov models to detect distant homologs.

  • Structural prediction: Use tools like AlphaFold2 or RoseTTAFold to predict 3D structure, followed by structural similarity searches against proteins of known function.

  • Domain and motif analysis: Identify functional domains or sequence motifs that might suggest biochemical activities.

  • Gene neighborhood analysis: Examine conservation of genomic context across species, as functionally related genes often cluster together.

  • Co-expression network analysis: Identify genes with similar expression patterns across diverse conditions, suggesting functional relationships.

Z-curve methodology and related approaches have demonstrated success in recognizing protein-coding genes in the yeast genome with accuracy exceeding 95% . This suggests that integrating multiple computational approaches can provide reliable predictions even for challenging cases like uncharacterized proteins. For YGL152C, combining these methods with experimental validation represents the most robust approach to functional annotation.

How should researchers interpret phenotypic data from YGL152C deletion or overexpression experiments?

Interpreting phenotypic data from YGL152C manipulation experiments requires careful consideration:

Experimental ApproachInterpretation ConsiderationsPotential Confounding Factors
Gene deletionDirect effects may be masked by genetic redundancyCompensatory mechanisms, synthetic interactions
Conditional deletionReveals context-dependent functionsLeaky expression, adaptation to gradual depletion
OverexpressionCan reveal gain-of-function phenotypesToxicity, non-physiological interactions, aggregation
Point mutationsLinks specific amino acids to functionStructural destabilization vs. functional disruption
Fusion proteinsProvides localization and interaction dataTag interference with normal function

When analyzing growth phenotypes, it's crucial to assess multiple conditions (temperature, carbon source, stress agents) as YGL152C might only show phenotypes under specific circumstances. The transcriptional response to different carbon sources, such as glucose versus galactose or glycerol/lactate, can significantly affect expression patterns , potentially masking or revealing phenotypes depending on the experimental conditions.

What statistical methods are appropriate for analyzing high-throughput data related to YGL152C?

High-throughput data analysis for YGL152C research requires appropriate statistical approaches:

  • Differential expression analysis: For transcriptomic or proteomic data, employ methods like DESeq2 or limma that account for the specific characteristics of count data and technical variability.

  • Enrichment analysis: Use Gene Ontology (GO) or pathway enrichment tests with appropriate multiple testing correction (e.g., Benjamini-Hochberg) to identify functional categories associated with YGL152C perturbation.

  • Network analysis: Apply graph theory algorithms to identify modules or communities within interaction networks that include YGL152C.

  • Time series analysis: For dynamic data, use methods that account for temporal dependencies, such as smoothing splines or autoregressive models.

  • Integration of multiple data types: Employ Bayesian approaches or machine learning methods to combine evidence from diverse experimental sources.

When analyzing Z-curve-based prediction data, the YZ score provides a quantitative measure of coding potential, with scores above 0.5 indicating likely protein-coding genes . This statistical framework has demonstrated better than 95% accuracy in cross-validation tests, making it a reliable metric for computational gene identification in yeast.

What are common challenges in expressing and purifying recombinant YGL152C?

Researchers frequently encounter several challenges when working with recombinant YGL152C:

  • Low expression levels: YGL152C may express poorly, requiring optimization of codon usage, promoter strength, or induction conditions.

  • Protein insolubility: If YGL152C contains hydrophobic regions, it may form inclusion bodies, necessitating refolding protocols or detergent solubilization.

  • Protein instability: The protein may be subject to rapid degradation, requiring protease inhibitors or lower expression temperatures.

  • Purification interference: Post-translational modifications or interacting partners may complicate purification, requiring more stringent washing conditions.

  • Activity loss during storage: Proper storage in Tris-based buffer with 50% glycerol is recommended, with avoidance of repeated freeze-thaw cycles .

For working with YGL152C specifically, storage recommendations include maintaining stocks at -20°C or -80°C for extended storage, while keeping working aliquots at 4°C for no more than one week . These precautions help preserve protein integrity and activity for experimental applications.

How can researchers address difficulties in detecting YGL152C expression in native conditions?

Detection of natively expressed YGL152C can be challenging but can be addressed through several strategies:

  • Sensitive detection methods: Employ techniques like selected reaction monitoring (SRM) mass spectrometry or highly sensitive immunoassays.

  • Enrichment approaches: Use subcellular fractionation or specific precipitation methods to concentrate the protein before detection.

  • Induction screening: Test various environmental conditions to identify those that might upregulate YGL152C expression.

  • Epitope tagging: Introduce a small epitope tag at the genomic locus to facilitate detection without significantly altering function.

  • Single-cell analysis: Consider single-cell approaches if expression is heterogeneous within the population.

The RNA-based research approaches that have proven successful in yeast models may be particularly valuable when studying proteins with potentially low or condition-specific expression patterns. Techniques adapted from RNA biology could potentially capture transient or low-abundance expression events that might be missed by traditional protein detection methods.

What strategies can overcome difficulties in phenotypic characterization of YGL152C mutants?

When YGL152C mutants do not display obvious phenotypes, consider these advanced characterization strategies:

  • Synthetic genetic interaction screening: Test for genetic interactions with known pathways through double-mutant analysis.

  • Chemical genetic profiling: Screen for altered sensitivity to diverse chemical compounds that might reveal functional connections.

  • High-resolution phenotyping: Employ techniques like high-content microscopy or flow cytometry to detect subtle cellular changes.

  • Competitive fitness assays: Use barcode-tagged strains in pool competitions to detect mild fitness defects that accumulate over generations.

  • Condition expansion: Dramatically expand the range of tested conditions, including unusual carbon sources, stressors, or combinations thereof.

The response to different carbon sources can significantly affect gene expression patterns, with transcription during growth in galactose or glycerol/lactate often responding more dramatically to experimental manipulations than growth in glucose . This suggests that testing YGL152C mutants under alternative carbon source conditions might reveal phenotypes not apparent under standard glucose-based growth conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.