Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL165C (YGL165C)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YGL165C

The Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL165C (YGL165C) is a protein encoded by the YGL165C gene in the budding yeast Saccharomyces cerevisiae. Despite its designation as "uncharacterized," this protein is part of ongoing research efforts aimed at understanding its function and potential applications. Saccharomyces cerevisiae, commonly known as baker's yeast, is a widely used model organism in molecular biology and genetics due to its well-characterized genome and ease of manipulation .

Background on Saccharomyces cerevisiae as a Model Organism

Saccharomyces cerevisiae is chosen for research because it offers a robust framework for studying biological processes. It is particularly useful for understanding eukaryotic cell biology, as many of its cellular processes are conserved across eukaryotes, including humans . The yeast's genome has been fully sequenced, and extensive databases like the Saccharomyces Genome Database (SGD) provide comprehensive information on its genes and proteins .

Expression and Localization of YGL165C

Information on the expression and localization of YGL165C can be found in databases such as SGD. These databases often include data on gene expression levels under different conditions and cellular localization, which can provide clues about a protein's function .

Table 1: General Information on YGL165C

AttributeDescription
Gene NameYGL165C
Protein TypePutative uncharacterized protein
OrganismSaccharomyces cerevisiae
DatabaseSaccharomyces Genome Database (SGD)

Table 2: Expression and Localization Data

ConditionExpression LevelLocalization
To be determinedTo be determinedTo be determined

Tools for Analysis

  • Saccharomyces Genome Database (SGD): Provides comprehensive information on S. cerevisiae genes and proteins, including expression data and functional annotations .

  • Protein-Protein Interaction Databases: Useful for identifying potential interactions of YGL165C with other proteins, which can help infer its function .

Future Research Directions

Future studies on YGL165C could involve:

  • Functional Assays: To determine its role in cellular processes.

  • Protein-Protein Interaction Studies: To identify interacting partners.

  • Bioinformatics Analysis: To predict potential functions based on sequence similarity and structural analysis.

Given the current lack of specific data on YGL165C, these approaches would be essential for characterizing its function and potential applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YGL165C; G1814; Putative uncharacterized protein YGL165C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-192
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGL165C
Target Protein Sequence
MVTYPVQPWTNFIIVYIYVYVYEWKNLSESRPDCQLAGRTNNRQYMYMYIYIDVQMHYCE CELCEDTCLYSSFNSLMENGMSISFSAVFVVVYALPVSLILTGSIDILGLCSSGSREAKS RLSMLSALISPFCRGGFKLGNVVVMSTSDERPFRPKRTSRSAIPRPLTCAASSFALLWHD PPFDFRLLFLLV
Uniprot No.

Target Background

Database Links

STRING: 4932.YGL165C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What experimental techniques are most effective for initial characterization of YGL165C function?

For initial characterization of YGL165C function, implement a systematic approach combining multiple techniques. Begin with gene deletion studies to assess growth phenotypes under various conditions (temperature, carbon sources, stress). Follow with GFP tagging for localization studies using fluorescence microscopy. RNA-seq analysis during different growth phases can reveal expression patterns. For protein-level characterization, purify the recombinant protein using an affinity tag system and perform in vitro biochemical assays. This multi-faceted approach provides complementary data streams that can converge on potential functions.

  • How should researchers design experiments to determine if YGL165C is essential for yeast viability?

To determine if YGL165C is essential for yeast viability, implement a methodical experimental design following established principles . First, create a heterozygous diploid strain (YGL165C/ygl165c∆) using homologous recombination with a selectable marker. Induce sporulation and perform tetrad analysis, observing whether all four spores are viable. If YGL165C is essential, only two spores (containing the wild-type gene) will grow. Alternatively, use a conditional expression system where YGL165C is placed under a regulatable promoter in a complete deletion background. Systematically repress expression and monitor growth across multiple replicate cultures compared to control strains.

  • What are the best approaches for generating recombinant YGL165C protein for structural studies?

For generating recombinant YGL165C suitable for structural studies, selection of the appropriate expression system is critical. Consider the following expression systems based on your specific requirements:

Expression SystemAdvantagesLimitationsTypical YieldPost-translational Modifications
E. coli (pET)High yield, rapid growth, inexpensiveLimited PTMs, inclusion body formation10-100 mg/LMinimal
S. cerevisiaeNative environment, all PTMsLower yield, slower growth1-10 mg/LComplete native pattern
P. pastorisHigh density growth, secretionDifferent glycosylation pattern5-50 mg/LSimilar to native
Insect cellsHigh yield of soluble proteinComplex media, higher cost5-20 mg/LMost PTMs except complex glycosylation

Design constructs with cleavable affinity tags (His6, GST) positioned to minimize interference with protein folding. Optimize expression conditions through factorial experimental design , systematically varying temperature, induction time, and media composition.

  • How can researchers predict potential functions of YGL165C using bioinformatic approaches?

To predict potential functions of YGL165C using bioinformatics, implement a hierarchical analysis workflow. Start with sequence-based approaches: BLAST searches against multiple databases to identify homologs, InterProScan for domain identification, and multiple sequence alignments to identify conserved residues. Progress to structure-based prediction using AlphaFold2 or SWISS-MODEL to generate 3D models, followed by structural comparison using DALI or TM-align to identify proteins with similar folds despite low sequence identity. Analyze genomic context conservation across related yeast species to identify syntenic relationships. Apply machine learning tools that integrate sequence and structural features to predict function. Finally, examine high-throughput datasets including genetic interaction networks and co-expression data to identify functional associations.

Advanced Research Questions

  • How can researchers use two-hybrid analysis to identify interaction partners of YGL165C?

For two-hybrid analysis of YGL165C interaction partners, design a systematic screening approach similar to that described for proteasome proteins . Create both DNA-binding domain (BD) and activation domain (AD) fusions of YGL165C, ensuring proper folding by testing multiple truncation variants if necessary. For screening, use a comprehensive AD-fusion yeast library covering the entire S. cerevisiae proteome. Implement a stringent confirmation protocol: test interactions in both orientations (BD-YGL165C × AD-prey and AD-YGL165C × BD-prey), validate with secondary assays such as co-immunoprecipitation, and quantify interaction strength using β-galactosidase assays. Filter false positives by comparing against published interaction databases and control screens .

  • What methodologies should be used to investigate YGL165C's potential role in meiotic processes?

To investigate YGL165C's potential role in meiotic processes, employ a systematic approach informed by established meiotic research methodologies . Begin with expression profiling during meiotic progression using synchronized cultures and RT-qPCR or RNA-seq, comparing YGL165C expression patterns with known meiotic genes. Create genomic epitope-tagged strains (YGL165C-FLAG or YGL165C-HA) and perform ChIP-seq analysis during meiosis to identify potential DNA binding sites, comparing these with known recombination hotspots.

Based on research in related yeast proteins, meiotic chromosomes form a characteristic loop-axis structure where chromatin loops emanate from a proteinaceous axis containing components like Rec8, Hop1, and Red1 . In S. cerevisiae, Spo11-DSB formation is influenced by this chromosome organization, with DSBs forming preferentially in gene promoters within the chromatin loops . Analysis shows that axis proteins (Hop1, Red1) colocalize with cohesion subunit Rec8 along chromosomes, except in specific regions where their absence correlates with suppressed recombination .

  • How can CRISPR-Cas9 technology be optimized for studying YGL165C function in Saccharomyces cerevisiae?

To optimize CRISPR-Cas9 for studying YGL165C function, design a comprehensive experimental approach following systematic experimental design principles . Key parameters for guide RNA design in S. cerevisiae include:

ParameterOptimal ValueEffect on Editing EfficiencyNotes
GC content40-60%Higher efficiency with balanced GCAvoid extreme GC-rich or AT-rich sequences
Secondary structureMinimal hairpinsReduced efficiency with strong structuresUse RNA folding prediction tools
Seed regionNo mismatches allowedCritical for specificity8-12 nucleotides adjacent to PAM
PAM sequenceNGG preferredNAG has ~20% efficiency of NGGAlternative PAMs require engineered Cas9
Target positionWithin first 50% of ORFMore effective gene disruptionFor knockout experiments
Homology arm length40-60 bp each sideIncreased HDR efficiencyOptimal for gene editing in yeast

For precise gene editing, design repair templates with homology arms flanking the desired modification, incorporating silent mutations in the PAM site to prevent re-cutting .

  • What experimental design is most appropriate for resolving contradictory findings about YGL165C function?

To resolve contradictory findings about YGL165C function, implement a systematic experimental design based on established methodological principles . First, identify specific variables that might explain discrepancies: strain background differences, growth conditions, assay sensitivities, or genetic interactions. Design factorial experiments that systematically vary these factors while measuring multiple output variables. Implement both between-subjects (comparing different strains) and within-subjects (same strain under different conditions) designs to increase robustness . Control for extraneous variables by standardizing growth media, temperature, and cell density across experiments. For each contradictory finding, design validation experiments using orthogonal techniques that rely on different principles but address the same biological question.

  • How should researchers investigate potential post-translational modifications of YGL165C?

To investigate potential post-translational modifications (PTMs) of YGL165C, implement a multi-faceted approach combining computational prediction with experimental validation. Begin with bioinformatic prediction tools specific to each PTM type (phosphorylation, ubiquitination, sumoylation, etc.) to identify candidate sites. Create a genomically integrated tagged version of YGL165C (TAP-tag or FLAG-tag) and purify the protein under native conditions from cells grown in various environmental conditions. Analyze purified protein using high-resolution mass spectrometry with multiple fragmentation methods (CID, ETD, HCD) to maximize PTM detection. Validate identified modifications using site-specific antibodies or by mutating modified residues to non-modifiable amino acids (e.g., S→A for phosphorylation) and assessing functional consequences.

  • What approaches should be used to determine if YGL165C is involved in chromosome organization during meiosis?

To determine if YGL165C participates in chromosome organization during meiosis, design a comprehensive experimental approach informed by established meiotic research methodologies . First, analyze YGL165C localization during meiotic progression using chromosomal spreads and immunofluorescence microscopy, comparing its distribution with known axis proteins (Hop1, Red1) and synaptonemal complex components (Zip1) .

Studies in yeasts show that the synaptonemal complex protein Zip1 forms continuous linear structures along paired chromosomes, with an average length of 13.86 micrometers in L. kluyveri compared to 28 micrometers in S. cerevisiae . This ~2-fold difference in synaptonemal complex length correlates with a ~4-fold difference in recombination frequency and differences in chromosome width (1.26 μm in L. kluyveri vs. 0.83 μm in S. cerevisiae), suggesting species-specific regulation of chromatin loop size . Perform Hi-C experiments in wild-type and ygl165c∆ mutants to detect potential alterations in this chromosome organization pattern.

  • How can researchers design experiments to determine if YGL165C has an enzymatic function?

To determine if YGL165C has enzymatic function, design a systematic experimental approach combining structural prediction with biochemical characterization. Begin with in-depth structural analysis using AlphaFold2 predictions and comparison to known enzyme structures to identify potential catalytic residues or substrate binding pockets. Generate recombinant YGL165C protein with various purification tags and expression systems to ensure proper folding. Perform broad-spectrum enzyme activity screens testing multiple substrate classes (nucleotides, carbohydrates, lipids, amino acids, etc.) under varying pH and metal ion conditions. For candidate substrates showing activity, determine detailed enzyme kinetics (Km, kcat, inhibition patterns). Create point mutations of predicted catalytic residues and measure their effect on activity.

  • What methods should be employed to study YGL165C behavior under environmental stress conditions?

To study YGL165C behavior under environmental stress conditions, implement a multi-level analysis approach following systematic experimental design principles . First, design a factorial experiment testing multiple stress conditions (oxidative, osmotic, temperature, nutrient deprivation) at varying intensities and durations. Monitor transcriptional and translational responses of YGL165C using RT-qPCR and Western blotting with epitope-tagged strains. Track protein localization changes during stress using time-lapse microscopy with GFP-tagged YGL165C. Compare growth and survival phenotypes between wild-type and ygl165c∆ strains across all stress conditions, generating heat maps of condition-specific sensitivity. For mechanistic insights, perform genetic interaction screens under stress conditions to identify synthetic interactions that emerge only under specific stresses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.