Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL204C (YGL204C)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YGL204C (YGL204C) is a recombinant protein derived from the yeast Saccharomyces cerevisiae. This protein is encoded by the gene YGL204C (UniProt ID: P53089) and remains functionally uncharacterized despite its identification in genomic and proteomic studies. Its recombinant form is produced in Escherichia coli with an N-terminal His-tag, enabling purification via affinity chromatography. Below is a detailed analysis of its production, characteristics, and research applications.

Gene Information

AttributeValue
ChromosomeVII
Genomic Location111700..112005 (complement strand)
Molecular Weight11,359.9 Da
Isoelectric Point10.92
Protein Length101 amino acids
Subcellular LocalizationEndoplasmic reticulum (ER)
Expression StatusNo expression data available in standard conditions

Protein Sequence

The full-length sequence (1–101 amino acids) is:
MNGTDILRFLQSSPTISYSKHFILITACPLFVLGLLLLGLRTAMFKQVRGKTTTSRNRGVIAAKLLVAWYLATIVMYIAKSEMWKYAFAVSLLLNSLALFF .

Recombinant Production

ParameterDetail
Host SystemE. coli
Expression VectorNot specified (varies by provider)
TagN-terminal His-tag
Purity>90% (SDS-PAGE confirmed)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionSterile water (0.1–1.0 mg/mL) with optional glycerol (5–50%)

Key Suppliers

SupplierProduct
Creative BioMartRFL20068SF (1–101 aa, His-tagged)
AnagnosticsELISA-grade recombinant protein
BiozoomerCustom expression (E. coli, yeast, mammalian systems)

Functional Studies

  • Protein Localization: Confirmed ER localization via SWAT-GFP/mCherry fusion studies .

  • Proteogenomic Identification: Detected via ribosome profiling and mass spectrometry .

  • Antibody Development: Rabbit polyclonal antibodies (e.g., MBS7160129) enable ELISA and Western blot detection .

Experimental Tools

ToolApplication
ELISA KitsQuantitative detection in yeast lysates
Custom RecombinantsStructure-function studies, tag optimization (e.g., GST, MBP)
AntibodiesImmunoprecipitation, subcellular localization assays

Research Challenges and Gaps

  1. Functional Uncertainty: No annotated biological process or molecular function despite ER localization .

  2. Expression Limitations: No detectable mRNA/protein under standard growth conditions .

  3. Structural Insights: No crystallographic data or functional motifs reported .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery estimates.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize development with the specified tag.
Synonyms
YGL204C; Uncharacterized protein YGL204C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGL204C
Target Protein Sequence
MNGTDILRFLQSSPTISYSKHFILITACPLFVLGLLLLGLRTAMFKQVRGKTTTSRNRGV IAAKLLVAWYLATIVMYIAKSEMWKYAFAVSLLLNSLALFF
Uniprot No.

Target Background

Database Links

KEGG: sce:YGL204C

STRING: 4932.YGL204C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YGL204C and why is it classified as a "dubious" open reading frame?

YGL204C is a putative uncharacterized protein in Saccharomyces cerevisiae that has been classified as a dubious open reading frame (ORF). This classification indicates that based on current experimental evidence and comparative sequence analyses, this genomic region is unlikely to encode a functional protein . Dubious ORFs typically lack conservation across related species, show limited expression evidence, may overlap with other verified genes, or possess sequence characteristics inconsistent with protein-coding genes.

How is YGL204C expression detected under different cellular conditions?

When cells are subjected to stress conditions such as DTT (which induces ER stress), H₂O₂ (oxidative stress), or starvation, the protein appears to localize to the cytosol with intensity values of 16.82, 16.12, and 16.58 respectively . These values represent only minor fluctuations from baseline, suggesting that if expressed, YGL204C does not dramatically respond to these particular stress conditions.

For more reliable detection of low-abundance transcripts like YGL204C, researchers should consider:

  • Quantitative RT-PCR with highly specific primers

  • RNA-seq with sufficient depth of coverage

  • Single-cell RNA-seq to capture potential cell-to-cell variation

  • Ribosome profiling to determine if the transcript is actually translated

What localization patterns have been observed for YGL204C and what do they suggest about its potential function?

Localization studies using different tagging strategies have yielded variable results for YGL204C:

Expression SystemLocalizationIntensityFold Change
C' GFP library in SDbelow threshold15.93-
N' NOP1pr-GFP in SDER30.4807
N' TEF2pr-mCherry in SDER10.0356
N' NATIVEpr-GFP in SDbelow threshold22.1953
N' TEF2pr-VC and Cyto-VN in SDbelow threshold23.995
C' GFP library in SD+DTTcytosol16.821.05
C' GFP library in SD+H₂O₂cytosol16.121.01
C' GFP library in Starvation Mediacytosol16.581.04

The inconsistent localization patterns (ER vs. cytosol) across different tagging strategies may suggest several possibilities :

  • The protein might shuttle between compartments depending on cellular conditions

  • Tagging position (N' vs. C') may affect localization

  • Overexpression using strong promoters (NOP1pr, TEF2pr) may result in mislocalization

  • The observed patterns could be artifacts since YGL204C is likely not a functional protein

What recombinant techniques are most suitable for investigating YGL204C function?

When investigating dubious ORFs like YGL204C, a multi-faceted approach combining several recombinant techniques is recommended:

  • CRISPR-Cas9 genome editing: Create precise deletions or modifications of YGL204C to assess phenotypic consequences. This method is preferable to traditional homologous recombination as it minimizes disruption to adjacent genomic regions.

  • Fusion protein approaches: Similar to those used in localization studies, but extended to include:

    • Split-ubiquitin systems for detecting potential protein interactions

    • Degron tagging to assess the consequences of rapid protein depletion

    • SNAP/HALO tags for live-cell imaging and protein turnover studies

  • Heterologous expression: Express YGL204C in different yeast species or other model organisms to observe potential functions that might be masked in S. cerevisiae by genetic redundancy.

The methods employed in recombinant S. cerevisiae studies provide valuable templates. For instance, the approach described for creating recombinant yeast expressing target proteins could be adapted for YGL204C characterization .

How can synthetic recombinant populations be utilized to study potential phenotypes associated with YGL204C?

Synthetic recombinant populations provide powerful platforms for uncovering subtle phenotypes that might be associated with dubious ORFs like YGL204C. These approaches are particularly valuable when standard single-gene studies fail to reveal clear functions.

Two main strategies can be employed based on established methodologies for creating diverse recombinant S. cerevisiae populations :

  • K-type populations (simpler approach):

    • Mix haploid strains with YGL204C variants (wild-type, deletion, point mutations)

    • Allow random mating to produce diverse diploid populations

    • Subject populations to various selection conditions

    • Sequence populations over time to detect enrichment/depletion of specific YGL204C variants

  • S-type populations (more controlled approach):

    • Create specific pairwise crosses between strains with YGL204C variants

    • Isolate and verify meiotic products through tetrad dissection

    • Validate proper segregation of markers

    • Create defined recombinant populations with known genetic compositions

The S-type approach, while more labor-intensive, offers advantages in terms of producing populations with more equal haplotype representation and higher levels of genetic variation . This approach might reveal subtle fitness effects or genetic interactions involving YGL204C that would be missed in simpler experimental designs.

After creating these populations, various experimental evolution approaches can be applied:

  • Continuous culture under selective conditions

  • Serial transfer experiments

  • Colony size monitoring on various media

  • Competitive fitness assays

What genomic sequencing and analysis methods are optimal for characterizing YGL204C variants in experimental populations?

When studying YGL204C variants in experimental populations, several sequencing and analysis approaches can be employed:

  • Targeted sequencing approaches:

    • Amplicon sequencing of the YGL204C locus to identify specific variants

    • Capture-based enrichment for the genomic region containing YGL204C

    • Barcode sequencing if genetic variants are tagged with unique barcodes

  • Whole-genome sequencing strategies:

    • Population sequencing at different timepoints to track frequency changes of variants

    • Deep sequencing (>100X coverage) to detect low-frequency variants

    • Long-read sequencing to resolve structural variants affecting YGL204C

Based on established methodologies, populations should be sequenced at multiple timepoints (e.g., initially, after 6 cycles of outcrossing, and after 12 cycles) to track changes in YGL204C variant frequencies . This temporal sampling allows detection of subtle selection effects that might indicate functional relevance despite YGL204C's dubious classification.

For optimal results, integrating variant data with phenotypic measurements and expression data provides a more comprehensive understanding of potential YGL204C functions or effects.

How should researchers interpret contradictory localization data for YGL204C and what controls are essential?

The contradictory localization data for YGL204C (showing both ER and cytosolic localization under different conditions and tagging strategies) presents a significant interpretative challenge . To properly address these contradictions, researchers should implement:

  • Essential controls:

    • Empty vector controls to establish baseline fluorescence

    • Known ER and cytosolic markers co-expressed with YGL204C fusions

    • Western blot verification of fusion protein integrity (to rule out proteolytic cleavage)

    • Comparison with other dubious ORFs to establish typical behavior patterns

  • Systematic tagging approach:

    • Test both N- and C-terminal tags simultaneously in the same cells

    • Use multiple fluorescent proteins with different spectral properties

    • Employ small epitope tags (HA, FLAG, Myc) alongside fluorescent proteins

    • Test internal tagging at positions predicted not to disrupt potential structural elements

  • Quantitative image analysis:

    • Implement automated, unbiased image quantification

    • Use colocalization coefficients (Pearson's, Mander's) with established markers

    • Track cells over time to detect potential dynamic localization changes

    • Analyze population distributions rather than relying on "representative" images

  • Complementary approaches:

    • Subcellular fractionation and Western blotting

    • Proximity labeling approaches (BioID, APEX)

    • Protease protection assays to determine membrane topology if ER-localized

    • Glycosylation site mapping to confirm ER luminal exposure

When interpreting contradictory data, researchers should consider the possibility that YGL204C's dubious status may result in inconsistent expression and localization patterns that reflect experimental artifacts rather than biological reality.

What strategies can be employed to investigate potential genetic interactions involving YGL204C?

Despite its dubious classification, YGL204C may participate in genetic interactions that could reveal functional relevance. Several approaches can uncover such relationships:

  • Synthetic genetic array (SGA) analysis:

    • Create YGL204C deletion or overexpression strains

    • Cross systematically with genome-wide deletion/DAmP collections

    • Quantify colony sizes to identify synthetic lethal/sick relationships

    • Validate hits with targeted growth assays and genetic complementation

  • Quantitative trait locus (QTL) mapping:

    • Utilize synthetic recombinant populations with YGL204C variants

    • Phenotype populations under various conditions

    • Perform genome-wide association to identify loci interacting with YGL204C

  • Transcriptome analysis in YGL204C mutant backgrounds:

    • RNA-seq of YGL204C deletion/overexpression strains

    • Identify differentially expressed genes that may function in related pathways

    • Validate with targeted RT-qPCR and reporter assays

  • Modifier screens:

    • Use YGL204C mutants with subtle phenotypes as sensitized backgrounds

    • Perform genome-wide screens for enhancers/suppressors

    • Focus on specific pathways suggested by preliminary data

Existing data indicates that YGL204C shows differential behavior in certain genetic backgrounds. For example, in a CCT mutant background, YGL204C shows a significant change (marked "Yes" in the significance column), suggesting potential genetic interaction . This provides a starting point for more comprehensive interaction studies.

What approaches can determine if the YGL204C locus has non-protein-coding functions?

While YGL204C is unlikely to encode a functional protein, the genomic locus might still have biological relevance through non-protein-coding mechanisms:

  • Transcriptional analysis:

    • Strand-specific RNA-seq to characterize transcription of the region

    • CAGE-seq to map transcription start sites in and around YGL204C

    • 3'-end sequencing to identify potential alternative transcripts

    • Single-molecule long-read sequencing to fully characterize transcript structure

  • Chromatin structure analysis:

    • ATAC-seq or MNase-seq to assess chromatin accessibility

    • ChIP-seq for histone modifications to identify potential regulatory elements

    • CUT&RUN or CUT&Tag for higher resolution transcription factor binding

    • Chromatin conformation capture (Hi-C, Micro-C) to identify long-range interactions

  • Functional genomics approaches:

    • CRISPR interference (CRISPRi) to inhibit transcription without changing sequence

    • CRISPR activation (CRISPRa) to enhance transcription of the region

    • Antisense oligonucleotides to block potential regulatory RNAs

    • Targeted RNA degradation using CRISPR-Cas13 to assess RNA-level functions

  • Comparative genomics:

    • Analysis of sequence conservation patterns typical of non-coding functional elements

    • RNA structure prediction and conservation analysis

    • Synteny analysis to identify positional conservation despite sequence divergence

When designing these experiments, it's important to consider that non-coding functions might be context-dependent, only appearing under specific conditions or genetic backgrounds.

What are the key challenges in expressing recombinant YGL204C for functional studies?

Expressing putative uncharacterized proteins like YGL204C presents several technical challenges:

  • Low natural expression levels:

    • Challenge: YGL204C shows below threshold expression in many conditions

    • Solution: Use strong, regulatable promoters like GAL1, TET, or ADH1

    • Solution: Optimize codon usage for efficient translation

    • Solution: Include stabilizing sequences or fusion partners to increase protein half-life

  • Potential toxicity when overexpressed:

    • Challenge: Even dubious ORFs can cause toxicity when highly expressed

    • Solution: Use tightly regulated inducible systems with minimal leaky expression

    • Solution: Express in specialized strains with reduced proteotoxic stress

    • Solution: Employ degron systems for rapid protein removal if toxicity emerges

  • Verification of expression:

    • Challenge: Distinguishing true expression from experimental artifacts

    • Solution: Use multiple epitope tags at different positions

    • Solution: Implement dual detection systems (e.g., fluorescent tag + epitope tag)

    • Solution: Validate with orthogonal methods (Western blot, mass spectrometry)

  • Purification difficulties:

    • Challenge: Dubious ORFs may not fold properly or form aggregates

    • Solution: Screen multiple solubility and affinity tags (MBP, GST, His, SUMO)

    • Solution: Optimize extraction conditions (detergents, salt, pH)

    • Solution: Consider native purification approaches with specific antibodies

Learning from successful recombinant yeast expression systems, researchers can incorporate methods where whole, recombinant S. cerevisiae yeast are engineered to express target proteins . This might be particularly useful for YGL204C where traditional expression and purification may be challenging.

How can researchers design definitive experiments to determine if YGL204C has biological significance?

To resolve the question of whether YGL204C has biological significance despite its dubious classification, researchers should design definitive experiments with the following principles:

  • Comprehensive genetic manipulation:

    • Create precise deletions, point mutations, and frameshift mutations

    • Compare phenotypes across multiple genetic backgrounds

    • Implement complementation tests with wild-type and mutant versions

    • Use CRISPR-based methods for scarless genome editing

  • High-sensitivity phenotyping:

    • Employ high-throughput growth profiling across hundreds of conditions

    • Implement competitive fitness assays with single-cell resolution

    • Use flow cytometry-based reporters to detect subtle cellular responses

    • Apply metabolomic and proteomic profiling to detect pathway alterations

  • Evolutionary approaches:

    • Create synthetic recombinant populations with and without YGL204C mutations

    • Subject to long-term experimental evolution under various conditions

    • Track allele frequencies over many generations

    • Compare across closely related yeast species

  • Integrative analysis:

    • Combine multiple data types (genomic, transcriptomic, proteomic)

    • Use machine learning approaches to detect subtle patterns

    • Implement Bayesian analysis to quantify confidence in biological significance

    • Develop custom statistical approaches for dubious ORFs

A robust experimental design would include both population-level approaches (similar to those used in synthetic recombinant population studies ) and single-cell approaches to capture heterogeneity that might be masked in bulk experiments.

What considerations are important when interpreting YGL204C expression data in different stress conditions?

When interpreting YGL204C expression data across different stress conditions, several important considerations must be addressed:

  • Background signal and detection thresholds:

    • YGL204C shows below threshold expression in standard conditions

    • Slight increases under stress conditions may reflect technical variation

    • Establish rigorous statistical thresholds for distinguishing real changes

    • Include multiple verified and dubious ORFs as comparative controls

  • Stress-specific technical artifacts:

    • Certain stresses (heat, oxidative) can increase background fluorescence

    • Some conditions may alter protein stability independent of expression

    • Stress can change cellular morphology affecting localization patterns

    • Implement appropriate normalization strategies for each condition

  • Temporal dynamics:

    • Expression might be transient during stress adaptation

    • Implement time-course experiments with appropriate temporal resolution

    • Consider recovery phases after stress removal

    • Use time-lapse microscopy to track individual cells

  • Cross-validation strategies:

    • Verify fluorescent protein data with orthogonal methods

    • Combine imaging with flow cytometry for quantitative assessment

    • Use RT-qPCR to validate transcriptional changes

    • Implement ribosome profiling to distinguish transcription from translation

The existing data shows that under DTT, H₂O₂, and starvation conditions, YGL204C shows only minimal fold-changes in expression (1.05, 1.01, and 1.04 respectively) . These small changes highlight the importance of rigorous statistical analysis and multiple experimental replicates when studying dubious ORFs under stress conditions.

How does evolutionary analysis inform our understanding of YGL204C's dubious status?

Evolutionary analysis provides critical context for interpreting YGL204C's classification as a dubious ORF:

  • Sequence conservation analysis:

    • Examine conservation across Saccharomyces species and broader fungal taxa

    • Calculate dN/dS ratios to detect selective pressure signatures

    • Look for conserved protein domains or motifs

    • Compare with known functional and dubious ORFs as benchmarks

  • Synteny analysis:

    • Examine the genomic context of YGL204C across related species

    • Determine if the locus maintains positional relationships with adjacent genes

    • Identify potential rearrangements that might affect functionality

    • Consider the possibility of overlapping genes or regulatory elements

  • Comparative expression studies:

    • Assess if orthologs in other species show expression patterns

    • Compare cellular localization across species if possible

    • Examine condition-specific expression conservation

    • Use cross-species complementation to test functional conservation

  • Evolutionary trajectory reconstruction:

    • Determine if YGL204C represents a degenerating gene, recent pseudogene, or ancient non-coding sequence

    • Look for signs of recent loss of function (e.g., intact ORF in close relatives)

    • Calculate the age of potentially inactivating mutations

    • Consider alternative evolutionary scenarios (e.g., species-specific neofunctionalization)

The lack of comprehensive cross-species data for YGL204C underscores the need for comparative genomic approaches to definitively establish its evolutionary status and potential biological significance.

The methodologies used in synthetic recombinant population studies could be adapted to create cross-species hybrids to further explore YGL204C conservation and function .

What computational methods can predict potential functions of YGL204C despite its "dubious" classification?

Despite YGL204C's dubious classification, advanced computational methods may reveal potential functions:

  • Structural prediction approaches:

    • Apply AlphaFold2 or RoseTTAFold to predict potential protein structure

    • Use structure-based function prediction tools (ProFunc, COFACTOR)

    • Identify potential binding pockets or catalytic sites

    • Perform molecular dynamics simulations to assess structural stability

  • Network-based inference:

    • Integrate YGL204C into protein-protein interaction networks

    • Apply guilt-by-association methods to predict function

    • Use co-expression networks across multiple conditions

    • Implement random forest or graph neural network approaches

  • Sequence-based predictions:

    • Apply sensitive profile Hidden Markov Models to detect remote homology

    • Use position-specific scoring matrices to identify functional motifs

    • Implement deep learning approaches trained on known proteins

    • Consider non-canonical translation products (alternative start sites, readthrough)

  • Integrative multi-omics approaches:

    • Combine genomic, transcriptomic, and proteomic data

    • Apply transfer learning across different data types

    • Use semi-supervised learning with limited labeled data

    • Implement Bayesian integration of multiple prediction methods

These computational approaches should be calibrated using known dubious and verified ORFs to establish appropriate confidence thresholds and minimize false positive predictions.

The data showing YGL204C localization to the ER in some experimental conditions could provide a starting point for computational analyses focused on ER-associated functions, despite its dubious classification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.