Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YGL204C (YGL204C) is a recombinant protein derived from the yeast Saccharomyces cerevisiae. This protein is encoded by the gene YGL204C (UniProt ID: P53089) and remains functionally uncharacterized despite its identification in genomic and proteomic studies. Its recombinant form is produced in Escherichia coli with an N-terminal His-tag, enabling purification via affinity chromatography. Below is a detailed analysis of its production, characteristics, and research applications.
The full-length sequence (1–101 amino acids) is:
MNGTDILRFLQSSPTISYSKHFILITACPLFVLGLLLLGLRTAMFKQVRGKTTTSRNRGVIAAKLLVAWYLATIVMYIAKSEMWKYAFAVSLLLNSLALFF .
| Supplier | Product |
|---|---|
| Creative BioMart | RFL20068SF (1–101 aa, His-tagged) |
| Anagnostics | ELISA-grade recombinant protein |
| Biozoomer | Custom expression (E. coli, yeast, mammalian systems) |
Protein Localization: Confirmed ER localization via SWAT-GFP/mCherry fusion studies .
Proteogenomic Identification: Detected via ribosome profiling and mass spectrometry .
Antibody Development: Rabbit polyclonal antibodies (e.g., MBS7160129) enable ELISA and Western blot detection .
KEGG: sce:YGL204C
STRING: 4932.YGL204C
YGL204C is a putative uncharacterized protein in Saccharomyces cerevisiae that has been classified as a dubious open reading frame (ORF). This classification indicates that based on current experimental evidence and comparative sequence analyses, this genomic region is unlikely to encode a functional protein . Dubious ORFs typically lack conservation across related species, show limited expression evidence, may overlap with other verified genes, or possess sequence characteristics inconsistent with protein-coding genes.
When cells are subjected to stress conditions such as DTT (which induces ER stress), H₂O₂ (oxidative stress), or starvation, the protein appears to localize to the cytosol with intensity values of 16.82, 16.12, and 16.58 respectively . These values represent only minor fluctuations from baseline, suggesting that if expressed, YGL204C does not dramatically respond to these particular stress conditions.
For more reliable detection of low-abundance transcripts like YGL204C, researchers should consider:
Quantitative RT-PCR with highly specific primers
RNA-seq with sufficient depth of coverage
Single-cell RNA-seq to capture potential cell-to-cell variation
Ribosome profiling to determine if the transcript is actually translated
Localization studies using different tagging strategies have yielded variable results for YGL204C:
| Expression System | Localization | Intensity | Fold Change |
|---|---|---|---|
| C' GFP library in SD | below threshold | 15.93 | - |
| N' NOP1pr-GFP in SD | ER | 30.48 | 07 |
| N' TEF2pr-mCherry in SD | ER | 10.03 | 56 |
| N' NATIVEpr-GFP in SD | below threshold | 22.19 | 53 |
| N' TEF2pr-VC and Cyto-VN in SD | below threshold | 23.99 | 5 |
| C' GFP library in SD+DTT | cytosol | 16.82 | 1.05 |
| C' GFP library in SD+H₂O₂ | cytosol | 16.12 | 1.01 |
| C' GFP library in Starvation Media | cytosol | 16.58 | 1.04 |
The inconsistent localization patterns (ER vs. cytosol) across different tagging strategies may suggest several possibilities :
The protein might shuttle between compartments depending on cellular conditions
Tagging position (N' vs. C') may affect localization
Overexpression using strong promoters (NOP1pr, TEF2pr) may result in mislocalization
The observed patterns could be artifacts since YGL204C is likely not a functional protein
When investigating dubious ORFs like YGL204C, a multi-faceted approach combining several recombinant techniques is recommended:
CRISPR-Cas9 genome editing: Create precise deletions or modifications of YGL204C to assess phenotypic consequences. This method is preferable to traditional homologous recombination as it minimizes disruption to adjacent genomic regions.
Fusion protein approaches: Similar to those used in localization studies, but extended to include:
Split-ubiquitin systems for detecting potential protein interactions
Degron tagging to assess the consequences of rapid protein depletion
SNAP/HALO tags for live-cell imaging and protein turnover studies
Heterologous expression: Express YGL204C in different yeast species or other model organisms to observe potential functions that might be masked in S. cerevisiae by genetic redundancy.
The methods employed in recombinant S. cerevisiae studies provide valuable templates. For instance, the approach described for creating recombinant yeast expressing target proteins could be adapted for YGL204C characterization .
Synthetic recombinant populations provide powerful platforms for uncovering subtle phenotypes that might be associated with dubious ORFs like YGL204C. These approaches are particularly valuable when standard single-gene studies fail to reveal clear functions.
Two main strategies can be employed based on established methodologies for creating diverse recombinant S. cerevisiae populations :
K-type populations (simpler approach):
Mix haploid strains with YGL204C variants (wild-type, deletion, point mutations)
Allow random mating to produce diverse diploid populations
Subject populations to various selection conditions
Sequence populations over time to detect enrichment/depletion of specific YGL204C variants
S-type populations (more controlled approach):
Create specific pairwise crosses between strains with YGL204C variants
Isolate and verify meiotic products through tetrad dissection
Validate proper segregation of markers
Create defined recombinant populations with known genetic compositions
The S-type approach, while more labor-intensive, offers advantages in terms of producing populations with more equal haplotype representation and higher levels of genetic variation . This approach might reveal subtle fitness effects or genetic interactions involving YGL204C that would be missed in simpler experimental designs.
After creating these populations, various experimental evolution approaches can be applied:
Continuous culture under selective conditions
Serial transfer experiments
Colony size monitoring on various media
Competitive fitness assays
When studying YGL204C variants in experimental populations, several sequencing and analysis approaches can be employed:
Targeted sequencing approaches:
Amplicon sequencing of the YGL204C locus to identify specific variants
Capture-based enrichment for the genomic region containing YGL204C
Barcode sequencing if genetic variants are tagged with unique barcodes
Whole-genome sequencing strategies:
Population sequencing at different timepoints to track frequency changes of variants
Deep sequencing (>100X coverage) to detect low-frequency variants
Long-read sequencing to resolve structural variants affecting YGL204C
Based on established methodologies, populations should be sequenced at multiple timepoints (e.g., initially, after 6 cycles of outcrossing, and after 12 cycles) to track changes in YGL204C variant frequencies . This temporal sampling allows detection of subtle selection effects that might indicate functional relevance despite YGL204C's dubious classification.
For optimal results, integrating variant data with phenotypic measurements and expression data provides a more comprehensive understanding of potential YGL204C functions or effects.
The contradictory localization data for YGL204C (showing both ER and cytosolic localization under different conditions and tagging strategies) presents a significant interpretative challenge . To properly address these contradictions, researchers should implement:
Essential controls:
Empty vector controls to establish baseline fluorescence
Known ER and cytosolic markers co-expressed with YGL204C fusions
Western blot verification of fusion protein integrity (to rule out proteolytic cleavage)
Comparison with other dubious ORFs to establish typical behavior patterns
Systematic tagging approach:
Test both N- and C-terminal tags simultaneously in the same cells
Use multiple fluorescent proteins with different spectral properties
Employ small epitope tags (HA, FLAG, Myc) alongside fluorescent proteins
Test internal tagging at positions predicted not to disrupt potential structural elements
Quantitative image analysis:
Implement automated, unbiased image quantification
Use colocalization coefficients (Pearson's, Mander's) with established markers
Track cells over time to detect potential dynamic localization changes
Analyze population distributions rather than relying on "representative" images
Complementary approaches:
Subcellular fractionation and Western blotting
Proximity labeling approaches (BioID, APEX)
Protease protection assays to determine membrane topology if ER-localized
Glycosylation site mapping to confirm ER luminal exposure
When interpreting contradictory data, researchers should consider the possibility that YGL204C's dubious status may result in inconsistent expression and localization patterns that reflect experimental artifacts rather than biological reality.
Despite its dubious classification, YGL204C may participate in genetic interactions that could reveal functional relevance. Several approaches can uncover such relationships:
Synthetic genetic array (SGA) analysis:
Create YGL204C deletion or overexpression strains
Cross systematically with genome-wide deletion/DAmP collections
Quantify colony sizes to identify synthetic lethal/sick relationships
Validate hits with targeted growth assays and genetic complementation
Quantitative trait locus (QTL) mapping:
Utilize synthetic recombinant populations with YGL204C variants
Phenotype populations under various conditions
Perform genome-wide association to identify loci interacting with YGL204C
Transcriptome analysis in YGL204C mutant backgrounds:
RNA-seq of YGL204C deletion/overexpression strains
Identify differentially expressed genes that may function in related pathways
Validate with targeted RT-qPCR and reporter assays
Modifier screens:
Use YGL204C mutants with subtle phenotypes as sensitized backgrounds
Perform genome-wide screens for enhancers/suppressors
Focus on specific pathways suggested by preliminary data
Existing data indicates that YGL204C shows differential behavior in certain genetic backgrounds. For example, in a CCT mutant background, YGL204C shows a significant change (marked "Yes" in the significance column), suggesting potential genetic interaction . This provides a starting point for more comprehensive interaction studies.
While YGL204C is unlikely to encode a functional protein, the genomic locus might still have biological relevance through non-protein-coding mechanisms:
Transcriptional analysis:
Strand-specific RNA-seq to characterize transcription of the region
CAGE-seq to map transcription start sites in and around YGL204C
3'-end sequencing to identify potential alternative transcripts
Single-molecule long-read sequencing to fully characterize transcript structure
Chromatin structure analysis:
ATAC-seq or MNase-seq to assess chromatin accessibility
ChIP-seq for histone modifications to identify potential regulatory elements
CUT&RUN or CUT&Tag for higher resolution transcription factor binding
Chromatin conformation capture (Hi-C, Micro-C) to identify long-range interactions
Functional genomics approaches:
CRISPR interference (CRISPRi) to inhibit transcription without changing sequence
CRISPR activation (CRISPRa) to enhance transcription of the region
Antisense oligonucleotides to block potential regulatory RNAs
Targeted RNA degradation using CRISPR-Cas13 to assess RNA-level functions
Comparative genomics:
Analysis of sequence conservation patterns typical of non-coding functional elements
RNA structure prediction and conservation analysis
Synteny analysis to identify positional conservation despite sequence divergence
When designing these experiments, it's important to consider that non-coding functions might be context-dependent, only appearing under specific conditions or genetic backgrounds.
Expressing putative uncharacterized proteins like YGL204C presents several technical challenges:
Low natural expression levels:
Potential toxicity when overexpressed:
Challenge: Even dubious ORFs can cause toxicity when highly expressed
Solution: Use tightly regulated inducible systems with minimal leaky expression
Solution: Express in specialized strains with reduced proteotoxic stress
Solution: Employ degron systems for rapid protein removal if toxicity emerges
Verification of expression:
Challenge: Distinguishing true expression from experimental artifacts
Solution: Use multiple epitope tags at different positions
Solution: Implement dual detection systems (e.g., fluorescent tag + epitope tag)
Solution: Validate with orthogonal methods (Western blot, mass spectrometry)
Purification difficulties:
Challenge: Dubious ORFs may not fold properly or form aggregates
Solution: Screen multiple solubility and affinity tags (MBP, GST, His, SUMO)
Solution: Optimize extraction conditions (detergents, salt, pH)
Solution: Consider native purification approaches with specific antibodies
Learning from successful recombinant yeast expression systems, researchers can incorporate methods where whole, recombinant S. cerevisiae yeast are engineered to express target proteins . This might be particularly useful for YGL204C where traditional expression and purification may be challenging.
To resolve the question of whether YGL204C has biological significance despite its dubious classification, researchers should design definitive experiments with the following principles:
Comprehensive genetic manipulation:
Create precise deletions, point mutations, and frameshift mutations
Compare phenotypes across multiple genetic backgrounds
Implement complementation tests with wild-type and mutant versions
Use CRISPR-based methods for scarless genome editing
High-sensitivity phenotyping:
Employ high-throughput growth profiling across hundreds of conditions
Implement competitive fitness assays with single-cell resolution
Use flow cytometry-based reporters to detect subtle cellular responses
Apply metabolomic and proteomic profiling to detect pathway alterations
Evolutionary approaches:
Integrative analysis:
Combine multiple data types (genomic, transcriptomic, proteomic)
Use machine learning approaches to detect subtle patterns
Implement Bayesian analysis to quantify confidence in biological significance
Develop custom statistical approaches for dubious ORFs
A robust experimental design would include both population-level approaches (similar to those used in synthetic recombinant population studies ) and single-cell approaches to capture heterogeneity that might be masked in bulk experiments.
When interpreting YGL204C expression data across different stress conditions, several important considerations must be addressed:
Background signal and detection thresholds:
Stress-specific technical artifacts:
Certain stresses (heat, oxidative) can increase background fluorescence
Some conditions may alter protein stability independent of expression
Stress can change cellular morphology affecting localization patterns
Implement appropriate normalization strategies for each condition
Temporal dynamics:
Expression might be transient during stress adaptation
Implement time-course experiments with appropriate temporal resolution
Consider recovery phases after stress removal
Use time-lapse microscopy to track individual cells
Cross-validation strategies:
Verify fluorescent protein data with orthogonal methods
Combine imaging with flow cytometry for quantitative assessment
Use RT-qPCR to validate transcriptional changes
Implement ribosome profiling to distinguish transcription from translation
The existing data shows that under DTT, H₂O₂, and starvation conditions, YGL204C shows only minimal fold-changes in expression (1.05, 1.01, and 1.04 respectively) . These small changes highlight the importance of rigorous statistical analysis and multiple experimental replicates when studying dubious ORFs under stress conditions.
Evolutionary analysis provides critical context for interpreting YGL204C's classification as a dubious ORF:
Sequence conservation analysis:
Examine conservation across Saccharomyces species and broader fungal taxa
Calculate dN/dS ratios to detect selective pressure signatures
Look for conserved protein domains or motifs
Compare with known functional and dubious ORFs as benchmarks
Synteny analysis:
Examine the genomic context of YGL204C across related species
Determine if the locus maintains positional relationships with adjacent genes
Identify potential rearrangements that might affect functionality
Consider the possibility of overlapping genes or regulatory elements
Comparative expression studies:
Assess if orthologs in other species show expression patterns
Compare cellular localization across species if possible
Examine condition-specific expression conservation
Use cross-species complementation to test functional conservation
Evolutionary trajectory reconstruction:
Determine if YGL204C represents a degenerating gene, recent pseudogene, or ancient non-coding sequence
Look for signs of recent loss of function (e.g., intact ORF in close relatives)
Calculate the age of potentially inactivating mutations
Consider alternative evolutionary scenarios (e.g., species-specific neofunctionalization)
The lack of comprehensive cross-species data for YGL204C underscores the need for comparative genomic approaches to definitively establish its evolutionary status and potential biological significance.
The methodologies used in synthetic recombinant population studies could be adapted to create cross-species hybrids to further explore YGL204C conservation and function .
Despite YGL204C's dubious classification, advanced computational methods may reveal potential functions:
Structural prediction approaches:
Apply AlphaFold2 or RoseTTAFold to predict potential protein structure
Use structure-based function prediction tools (ProFunc, COFACTOR)
Identify potential binding pockets or catalytic sites
Perform molecular dynamics simulations to assess structural stability
Network-based inference:
Integrate YGL204C into protein-protein interaction networks
Apply guilt-by-association methods to predict function
Use co-expression networks across multiple conditions
Implement random forest or graph neural network approaches
Sequence-based predictions:
Apply sensitive profile Hidden Markov Models to detect remote homology
Use position-specific scoring matrices to identify functional motifs
Implement deep learning approaches trained on known proteins
Consider non-canonical translation products (alternative start sites, readthrough)
Integrative multi-omics approaches:
Combine genomic, transcriptomic, and proteomic data
Apply transfer learning across different data types
Use semi-supervised learning with limited labeled data
Implement Bayesian integration of multiple prediction methods
These computational approaches should be calibrated using known dubious and verified ORFs to establish appropriate confidence thresholds and minimize false positive predictions.
The data showing YGL204C localization to the ER in some experimental conditions could provide a starting point for computational analyses focused on ER-associated functions, despite its dubious classification.