Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL214W (YGL214W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
YGL214W; Putative uncharacterized protein YGL214W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGL214W
Target Protein Sequence
MDDVRLHAIYQDITRDYLPPASLNHLMLLSKQTQHKLSFKSAPIPDLQPFFKNFTSKTPG SAKESPCSSTAKISSSISISSQCIFNVVILSFVFTSQNLNLPSHPALHNVSPESLNDRLM TQLECANSPRLACELWVGTDKEPILSPNSVSYRVMQPNEFES
Uniprot No.

Target Background

Database Links

STRING: 4932.YGL214W

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YGL214W and where is it located in the S. cerevisiae genome?

YGL214W is a putative uncharacterized protein in Saccharomyces cerevisiae, located on chromosome VII. The gene sequence is available in the Saccharomyces Genome Database (SGD), which maintains the reference genome sequence derived from laboratory strain S288C . The gene designation "YGL214W" follows the standard S. cerevisiae nomenclature, where "Y" indicates yeast, "G" represents chromosome VII, "L" denotes the left arm of the chromosome, "214" is the sequential open reading frame number, and "W" indicates that the gene is transcribed from the Watson (5' to 3') strand.

What bioinformatic tools are most appropriate for preliminary analysis of YGL214W?

For preliminary analysis of YGL214W, researchers should utilize a combination of sequence analysis tools available through the SGD platform. These include BLASTN and BLASTP for nucleotide and protein sequence comparisons, respectively, particularly against fungal databases to identify potential orthologs . Additionally, restriction fragment mapping and six-frame translation analysis can provide initial insights into the protein's structure. For functional prediction, GO (Gene Ontology) Annotations databases should be consulted to identify potential molecular functions, biological processes, and cellular components based on computational annotations and any available experimental evidence . Protein domain prediction tools such as Pfam, InterPro, and PROSITE can help identify conserved domains that might suggest function.

What is currently known about the expression profile of YGL214W?

YGL214W expression patterns can be analyzed through available high-throughput datasets in SGD. The database provides information on basic sequence-derived properties (length, molecular weight, isoelectric point) and experimentally determined characteristics such as median abundance and median absolute deviation . To comprehensively understand YGL214W expression, researchers should examine RNA-Seq data across different growth conditions, stress responses, and cell cycle stages. If available, protein abundance data from proteomics studies can reveal post-transcriptional regulation patterns. Expression correlation analysis with other genes may provide insights into potential functional relationships within biological pathways.

How can genetic barcoding be applied to study YGL214W function in experimental evolution studies?

Genetic barcoding represents a powerful approach for studying YGL214W function through experimental evolution. Researchers can develop a library of isogenic strains with unique 20 bp barcodes inserted upstream of specific loci, as demonstrated in high-throughput adaptation studies . To apply this to YGL214W research, construct strains with barcodes near YGL214W or in a YGL214W deletion background. These barcoded strains enable pooled fitness assays where multiple experimental conditions or genetic backgrounds can be tested simultaneously. The barcode sequences serve as molecular identifiers that can be quantified through next-generation sequencing to track population dynamics and fitness effects .
For experimental design, researchers should follow established protocols:

  • Create barcoded strain libraries with YGL214W mutations or in different genetic backgrounds

  • Grow pooled populations under selective conditions

  • Sample at regular intervals (0 hours and 48 hours initially)

  • Extract DNA and amplify barcode regions with indexed primers

  • Sequence barcodes and calculate relative fitness by comparing barcode frequencies over time
    This approach allows for high-throughput assessment of YGL214W's role under various selective pressures while controlling for strain background effects.

What are the most effective gene deletion strategies for characterizing YGL214W function?

To effectively characterize YGL214W function through gene deletion, researchers should employ a multifaceted approach combining precise gene targeting and comprehensive phenotypic analysis. The preferred method involves PCR-mediated gene replacement using selectable markers such as KanMX, which confers G418 resistance . When designing deletion constructs, include at least 40 bp of homology to regions flanking YGL214W to ensure precise targeting. After transformation, verify successful deletions through diagnostic PCR and sequencing of the integration junctions.
For phenotypic characterization, implement a systematic approach:

  • Assess growth rates in multiple media conditions (minimal, rich, various carbon sources)

  • Test sensitivity to various stresses (temperature, oxidative, osmotic, nutrient limitation)

  • Examine cell morphology and cell cycle progression

  • Analyze genetic interactions through synthetic genetic arrays

  • Perform transcriptome analysis to identify compensatory responses
    Additionally, create complemented strains by reintroducing YGL214W under its native promoter to confirm phenotypes are specifically due to the deletion. For more sophisticated analysis, consider creating temperature-sensitive alleles or using an auxin-inducible degron system for conditional depletion of the protein.

How can high-throughput fitness assays be optimized for measuring YGL214W phenotypes?

Optimizing high-throughput fitness assays for YGL214W phenotypic characterization requires careful experimental design and rigorous controls. Based on established protocols, implement a competition-based fitness assay system using barcoded strains . To specifically optimize this for YGL214W studies:

  • Create multiple YGL214W variant strains (deletion, point mutations, overexpression) with unique barcode identifiers

  • Include isogenic control strains with wild-type YGL214W containing different barcodes to control for barcode-specific effects

  • Conduct initial proof-of-concept experiments with 10+ replicates to establish assay reproducibility and determine variance

  • Optimize culture conditions by testing different media, temperatures, and stress conditions to identify those that reveal phenotypic differences

  • Implement rigorous contamination controls during DNA extraction and library preparation to prevent barcode cross-contamination
    To calculate fitness accurately, follow the established methodology of tracking barcode abundance changes between initial and final timepoints using next-generation sequencing . For statistical robustness, include at least six independent transformants per strain and conduct multiple biological replicates of each competition assay. This approach provides high-throughput, quantitative measurements of relative fitness that can reveal subtle phenotypic effects of YGL214W variants.

What approaches can distinguish direct versus indirect effects when studying YGL214W's role in cellular processes?

Distinguishing direct from indirect effects of YGL214W requires a systematic integration of multiple experimental approaches. Start with protein-protein interaction studies using techniques such as affinity purification coupled with mass spectrometry (AP-MS) or yeast two-hybrid screening to identify direct binding partners. Complement this with proximity labeling methods like BioID or APEX2 to capture transient or context-dependent interactions.
For transcriptional response analysis, implement time-course experiments following YGL214W perturbation, using either conditional alleles or regulated expression systems. Early transcriptional changes (within 15-30 minutes) are more likely to represent direct effects, while later changes often reflect secondary responses. Apply clustering analysis to categorize genes with similar expression patterns.
To establish causality in observed phenotypes, use the following strategy:

  • Create point mutations in predicted functional domains to disrupt specific interactions

  • Implement epistasis analysis by creating double mutants with genes in suspected pathways

  • Use complementation assays with chimeric proteins or domain swaps to identify functional regions

  • Apply chemical-genetic profiling to identify conditions that specifically affect YGL214W mutants
    Additionally, utilize ChIP-seq or RNA immunoprecipitation if YGL214W is suspected to interact with DNA or RNA. The integration of these approaches allows researchers to confidently distinguish direct molecular functions from downstream effects.

How can researchers effectively integrate YGL214W studies with global genetic interaction networks?

To effectively integrate YGL214W into global genetic interaction networks, researchers should employ a comprehensive, multi-layered approach. Begin with systematic genetic interaction mapping using synthetic genetic array (SGA) analysis, creating double mutants of YGL214W with genome-wide deletion libraries. Calculate genetic interaction scores based on colony size or growth rate deviations from expected values, and identify significant positive (suppressing) and negative (enhancing) interactions.
For network visualization and analysis:

  • Use established tools like Cytoscape to generate interaction maps

  • Apply community detection algorithms to identify functional modules

  • Calculate network statistics (degree, betweenness centrality) to assess YGL214W's position in the global network

  • Perform enrichment analysis of interacting genes using Gene Ontology terms
    Complement genetic interaction data with physical interaction mapping and co-expression analysis. Physical interactions can be identified through high-throughput methods like protein-fragment complementation assays, while co-expression patterns can be extracted from existing transcriptomic datasets. Integration of these diverse datasets provides a multidimensional view of YGL214W's functional context.
    For more sophisticated analysis, implement comparative network biology approaches by examining orthologous genes in related yeast species to identify evolutionarily conserved network properties. This integrated network analysis provides a systems-level understanding of YGL214W's role within cellular pathways.

What methods can detect potential regulatory roles of YGL214W in gene expression?

To investigate potential regulatory roles of YGL214W in gene expression, researchers should implement a multifaceted approach combining genomic, transcriptomic, and biochemical techniques. Begin with RNA-seq analysis comparing wild-type and YGL214W mutant strains under multiple conditions to identify differentially expressed genes. For greater sensitivity in detecting regulatory effects, consider nascent RNA sequencing methods like NET-seq or GRO-seq, which can capture transcriptional changes before post-transcriptional processing.
If YGL214W is suspected to interact with chromatin or transcription factors, implement the following approaches:

  • ChIP-seq to map genomic binding sites (if antibodies are available or using epitope-tagged versions)

  • DNase-seq or ATAC-seq to identify changes in chromatin accessibility

  • MNase-seq to detect alterations in nucleosome positioning

  • Genetic interaction analysis with known transcriptional regulators, particularly components of the Mediator complex which has been implicated in retrotransposon regulation
    For direct assessment of promoter interactions, consider reporter gene assays using promoters of genes identified as differentially expressed in YGL214W mutants. For instance, methods similar to those used to study Ty1 promoter activity could be adapted . Additionally, examine interaction with RNA processing machinery through RNA immunoprecipitation or CLIP-seq if YGL214W is suspected to affect post-transcriptional regulation.

How can CRISPR-Cas9 technologies be optimized for studying YGL214W in S. cerevisiae?

Optimizing CRISPR-Cas9 technologies for YGL214W studies requires careful consideration of yeast-specific factors and precise experimental design. For efficient gene editing in S. cerevisiae, researchers should implement a plasmid-based system expressing both Cas9 and guide RNAs (gRNAs) targeting YGL214W. When designing gRNAs, select target sequences with minimal off-target potential using yeast-specific prediction algorithms, and design multiple gRNAs targeting different regions of YGL214W to improve editing efficiency.
For precise gene modifications:

  • Design repair templates with at least 40 bp homology arms flanking the desired modification site

  • Include selectable markers (e.g., KanMX) for positive selection of edited cells

  • Consider including silent mutations in the PAM site or seed region to prevent re-cutting of edited sequences

  • Verify edits through sequencing and functional assays
    To achieve more sophisticated genetic manipulations, implement CRISPR activation (CRISPRa) or interference (CRISPRi) systems by using deactivated Cas9 (dCas9) fused to transcriptional activators or repressors. This allows for modulation of YGL214W expression without altering the genomic sequence. For temporal control, consider inducible Cas9 or gRNA expression systems driven by galactose-inducible or tetracycline-responsive promoters.
    Additionally, multiplex genome editing can be achieved by expressing multiple gRNAs simultaneously, enabling the study of genetic interactions between YGL214W and other genes. This comprehensive CRISPR toolkit provides researchers with precise control over YGL214W sequence and expression for detailed functional characterization.

What approaches can resolve contradictory results in YGL214W functional studies?

Resolving contradictory results in YGL214W functional studies requires a systematic troubleshooting approach that addresses potential sources of experimental variability. First, thoroughly document methodological differences between studies, including strain backgrounds, culture conditions, experimental protocols, and analytical methods. Strain background effects can significantly influence phenotypic outcomes, as demonstrated in studies of Mediator complex mutations that showed variable effects on retromobility in different genetic contexts .
Implement the following strategy to resolve contradictions:

  • Replicate key experiments in identical conditions using standardized strains and protocols

  • Test multiple independently derived mutant strains to control for secondary mutations

  • Employ complementation tests to confirm phenotypes are specifically due to YGL214W alterations

  • Conduct phenotypic assays across a range of conditions to identify context-dependent effects

  • Use quantitative assays with increased sensitivity, such as fluorescent reporter systems that have shown greater ability to detect subtle changes in gene expression compared to traditional methods
    For molecular phenotypes, apply orthogonal techniques to measure the same parameter. For example, if protein expression levels are contradictory between studies, compare results from western blotting, mass spectrometry, and fluorescent tagging approaches. When analyzing genetic interactions, consider using both targeted epistasis experiments and unbiased genome-wide screens to provide complementary perspectives.
    Finally, establish collaborative efforts between research groups reporting contradictory results to directly compare methodologies and develop consensus protocols. This comprehensive approach helps distinguish genuine biological complexity from technical artifacts.

How can researchers design experiments to distinguish the functional impact of YGL214W from closely related genes?

Designing experiments to distinguish the functional impact of YGL214W from closely related genes requires a sophisticated approach combining genetic engineering, comparative genomics, and high-resolution phenotyping. Begin with comprehensive sequence analysis to identify paralogous genes and determine their evolutionary relationships. For S. cerevisiae, which underwent whole-genome duplication in its evolutionary history, this is particularly important.
Implement the following experimental design strategy:

  • Create single and combinatorial gene deletions of YGL214W and its paralogs

  • Generate chimeric proteins by swapping domains between YGL214W and related genes

  • Introduce cross-species complementation using orthologs from related yeast species

  • Create allele-specific mutations that target unique residues in YGL214W not present in paralogs

  • Develop domain-specific antibodies or epitope tags that can distinguish between the proteins
    For functional characterization, implement high-throughput genetic barcode assays that can simultaneously track fitness effects of multiple genetic variants . This allows direct comparison of YGL214W mutants with paralog mutants under identical conditions. Additionally, utilize transcriptome and proteome profiling to identify distinct downstream effects of each gene, focusing on unique signatures rather than shared responses.
    To directly assess functional redundancy, design rescue experiments where YGL214W paralogs are expressed under the YGL214W promoter in a YGL214W deletion background. The degree of phenotypic rescue provides quantitative measures of functional overlap. This comprehensive approach provides a clear delineation of YGL214W-specific functions from those shared with related genes.

How conserved is YGL214W across yeast species and what does this suggest about its function?

The evolutionary conservation pattern of YGL214W across yeast species provides critical insights into its functional significance. To comprehensively assess conservation, researchers should perform comparative genomic analyses using specialized tools available through the Saccharomyces Genome Database, particularly BLASTN and BLASTP searches against fungal databases . These comparisons reveal the presence of orthologs in related species and the degree of sequence conservation.
Conservation analysis should examine multiple aspects:

  • Sequence conservation at both nucleotide and amino acid levels

  • Preservation of specific protein domains or motifs

  • Synteny analysis to determine if genomic context is maintained

  • Presence/absence patterns across the yeast phylogenetic tree
    Highly conserved regions likely represent functionally important domains, while variable regions may indicate species-specific adaptations. For proteins with unknown functions like YGL214W, conservation patterns can suggest functional importance—proteins conserved across distant yeast species often perform fundamental cellular processes, while those with limited distribution may have more specialized roles.
    Additionally, analyzing selection pressures through dN/dS ratios (comparing rates of nonsynonymous to synonymous substitutions) can identify regions under purifying or positive selection. Regions under strong purifying selection typically represent functionally critical domains. This evolutionary perspective provides a framework for generating hypotheses about YGL214W function that can guide experimental design.

What experimental approaches can determine if YGL214W interacts with retrotransposons in S. cerevisiae?

To determine if YGL214W interacts with retrotransposons in S. cerevisiae, researchers should implement a multi-faceted experimental approach targeting different aspects of retrotransposon biology. Given that host-encoded regulators have been shown to influence retromobility through interactions with promoters like those of Ty1 , YGL214W should be examined for similar activities.
First, implement retrotransposition frequency assays using reporter systems such as the Ty1 kanMXAI system, which allows quantification of retromobility events through selection of G418-resistant colonies . Compare retrotransposition frequencies between wild-type and YGL214W mutant strains to determine if YGL214W deletion or overexpression alters mobility rates.
For mechanistic investigations:

  • Assess Ty1 RNA levels using northern blot analysis or RT-qPCR to determine if YGL214W affects transcription or RNA stability

  • Examine Ty1 protein expression using western blots or reporter fusions like p22-Gag:GFP to detect changes in translation or protein stability

  • Investigate chromatin state at Ty1 elements using ChIP-seq to identify potential direct interactions between YGL214W and retrotransposon chromatin

  • Perform RNA immunoprecipitation to test for physical interactions between YGL214W and retrotransposon RNAs
    Additionally, conduct genetic interaction studies between YGL214W and known regulators of retrotransposition, such as components of the Mediator complex like Med2 and Med20, which have been shown to influence Ty1 mobility . Epistasis analysis can determine if YGL214W functions in established regulatory pathways or represents a novel regulatory mechanism.

What quality control measures are essential when working with recombinant YGL214W protein?

Ensuring high-quality recombinant YGL214W protein preparation requires rigorous quality control measures throughout the expression and purification process. When working with this putative uncharacterized protein, researchers should implement the following essential quality control procedures:

  • Expression verification: Confirm successful expression using SDS-PAGE and western blotting with antibodies against the protein or epitope tags. Compare observed molecular weight with the theoretical weight calculated from the amino acid sequence available in SGD .

  • Purity assessment: Evaluate protein purity using multiple methods:

    • Densitometric analysis of SDS-PAGE gels (aim for >95% purity)

    • Size-exclusion chromatography to detect aggregates or degradation products

    • Mass spectrometry to confirm protein identity and detect contaminants

  • Structural integrity validation:

    • Circular dichroism spectroscopy to verify secondary structure

    • Thermal shift assays to assess protein stability

    • Dynamic light scattering to evaluate homogeneity and detect aggregation

  • Functional validation:

    • Activity assays based on predicted function

    • Binding assays with potential interaction partners

    • For proteins of unknown function, compare wildtype with mutant versions

  • Batch-to-batch consistency:

    • Implement standardized purification protocols

    • Establish acceptance criteria for each quality parameter

    • Maintain detailed records of expression conditions and purification steps
      Additionally, conduct endotoxin testing if the protein will be used in cellular assays, and verify the absence of contaminating nucleases or proteases that could affect experimental outcomes. For long-term storage, assess stability under different conditions (temperature, buffer composition) to establish optimal preservation protocols. These comprehensive quality control measures ensure reliable and reproducible results in downstream applications.

How should researchers design experiments to detect potential regulatory effects of YGL214W mutations on cellular adaptation?

Designing experiments to detect potential regulatory effects of YGL214W mutations on cellular adaptation requires a carefully structured approach combining evolutionary experiments with detailed molecular analysis. Based on established protocols for studying adaptation in yeast, researchers should implement experimental evolution using barcoded strains . This allows high-throughput assessment of fitness effects across multiple conditions and genetic backgrounds.
Experimental design should include:

  • Creation of multiple YGL214W variant strains (deletion, point mutations, domain deletions) with unique barcode identifiers

  • Evolution under diverse selective pressures (chemical stresses, temperature fluctuations, nutrient limitations)

  • Sampling at regular intervals for fitness measurements and genomic analysis

  • Comparison of evolutionary trajectories between wildtype and mutant populations
    For molecular characterization, assess changes in global gene expression patterns using RNA-seq to identify genes and pathways affected by YGL214W mutations during adaptation. Additionally, implement time-course experiments to distinguish immediate versus evolved responses.
    To identify potential regulatory mechanisms, conduct the following analyses:

  • ChIP-seq to detect changes in transcription factor binding patterns

  • ATAC-seq to assess chromatin accessibility changes

  • Analysis of post-translational modifications of key regulatory proteins

  • Metabolomic profiling to identify altered metabolic pathways
    This comprehensive approach allows researchers to connect genetic changes to phenotypic outcomes and regulatory network reorganization during adaptation, providing insights into YGL214W's potential regulatory functions.

What are the best practices for reporting YGL214W research to ensure reproducibility across laboratories?

Ensuring reproducibility of YGL214W research across laboratories requires comprehensive documentation and standardized reporting practices. Based on best practices in yeast genetics and molecular biology, researchers should implement the following guidelines when publishing YGL214W studies:

  • Strain documentation:

    • Provide complete genotypes of all strains used, including background strain information

    • Deposit novel strains in public repositories (e.g., Yeast Genetic Resource Center)

    • Document strain construction methods in detail, including primers used for genetic modifications

    • Report the number of independent transformants analyzed for each experiment

  • Experimental conditions:

    • Specify exact media compositions, including source of components

    • Document growth conditions (temperature, aeration, culture vessel type)

    • Report cell density at experiment initiation and sampling points

    • Provide detailed protocols for specialized assays

  • Data analysis transparency:

    • Share raw data in public repositories (e.g., Gene Expression Omnibus for sequencing data)

    • Provide all scripts and software used for data processing and analysis

    • Clearly describe statistical methods, including tests used and significance thresholds

    • Report both biological and technical replicate numbers for all experiments

  • Reagent validation:

    • Validate key reagents (antibodies, plasmids) and report validation methods

    • Deposit plasmids in public repositories (e.g., Addgene)

    • Provide sequence verification data for constructs

  • Methodological details:

    • For fitness assays, report exact calculation methods and reference strains used

    • For high-throughput sequencing, document library preparation methods, sequencing platform, and depth

    • Describe controls for molecular contamination between samples By adhering to these reporting standards, researchers ensure that YGL214W studies can be effectively reproduced and extended across different laboratories, accelerating progress in understanding this uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.