Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL239C (YGL239C)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

YGL239C is encoded by the YGL239C gene located on chromosome VII of S. cerevisiae. Key features include:

PropertyDetails
UniProt IDP53069
Amino Acid Length104 residues
Molecular Weight~12 kDa (calculated)
Isoelectric Point (pI)Not experimentally determined
SequenceMKFLKNKAPANLVDNGRFVEAITCNKVKPNPSCVSNCLKFLSEVLAVEAITDSARNLATVSKSDILLFSLLQLSSNKQSGSSLPLFDLVFILLSTFFLFHNPCN

Recombinant Production

Commercial sources describe its recombinant expression and purification:

Expression System and Tagging

  • Host: Escherichia coli

  • Tag: N-terminal polyhistidine (His-tag) for affinity purification

  • Purity: >90% (SDS-PAGE verified)

Applications in Biotechnology

While functional studies are lacking, recombinant YGL239C is utilized in:

  • Antigen Production: As a control protein in immunological assays due to its yeast origin .

  • Protein Engineering: Serves as a scaffold for testing expression systems .

Limitations and Future Directions

  • Functional Gap: No experimental evidence links YGL239C to specific pathways or mechanisms .

  • Research Potential: Priority areas include crystallography for structural insights and knockout studies to assess phenotypic effects.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
YGL239C; HRE104; Putative uncharacterized protein YGL239C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGL239C
Target Protein Sequence
MKFLKNKAPANLVDNGRFVEAITCNKVKPNPSCVSNCLKFLSEVLAVEAITDSARNLATV SKSDILLFSLLQLSSNKQSGSSLPLFDLVFILLSTFFLFHNPCN
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YGL239C and why is it significant in Saccharomyces cerevisiae research?

YGL239C is a putative uncharacterized protein in Saccharomyces cerevisiae whose function remains to be fully elucidated. It is significant in yeast research because it represents one of many proteins within the yeast proteome that lacks clear functional annotation despite S. cerevisiae being one of the most thoroughly studied eukaryotic model organisms. Uncharacterized proteins like YGL239C are important targets for functional genomics as they may reveal novel biological pathways or mechanisms. S. cerevisiae has an extensive history of safe use in research and has been central to numerous fundamental discoveries in cell biology, making any uncharacterized components of its genome particularly interesting for investigation .

What experimental approaches are commonly used to study uncharacterized proteins like YGL239C?

Several complementary approaches are typically employed to study uncharacterized proteins:

  • Computational prediction methods: These include conserved domain analysis, subcellular localization prediction, physicochemical characterization, and comparative homology analysis.

  • Expression studies: Analyzing the expression patterns of YGL239C under various conditions to gain insights into its potential function.

  • Gene knockout/knockdown experiments: Creating YGL239C deletion strains to observe resulting phenotypes.

  • Protein interaction studies: Techniques such as yeast two-hybrid assays, co-immunoprecipitation, or proximity labeling to identify protein interaction partners.

  • Structural biology approaches: Determining the three-dimensional structure through X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy to infer function.

These methods have been successfully implemented for annotation of hypothetical proteins in numerous bacterial species and can be adapted for yeast proteins like YGL239C .

What are the physicochemical properties typically examined when characterizing proteins like YGL239C?

When characterizing uncharacterized proteins, researchers typically analyze the following physicochemical properties:

PropertyDescriptionSignificance
Instability Index (II)Measure of protein stabilityII values below 40 indicate stable proteins
Theoretical isoelectric point (pI)pH at which the protein carries no net chargeAffects protein solubility and interactions
GRAVY (Grand Average of Hydropathy)Indicates hydrophobicity/hydrophilicityNegative values suggest non-polar nature
Molecular WeightSize of the proteinInforms experimental approaches
Amino Acid CompositionDistribution of amino acidsCan suggest structural features

These parameters provide initial insights into protein behavior and stability under various experimental conditions. For instance, when characterizing hypothetical proteins in C. difficile, approximately 70% had instability index values below 40, suggesting stability, and theoretical pI values ranging from 4.05 to 11.99 .

How can experimental design be optimized for studying the effects of YGL239C deletion or overexpression?

When designing experiments to study the effects of YGL239C deletion or overexpression, researchers should consider implementing a multi-factorial design that accounts for various conditions:

  • Factorial design approach: Implement a factorial design that examines multiple variables simultaneously. For example, a design might examine the effects of YGL239C manipulation (deletion, wild-type, overexpression) under different growth conditions (carbon sources, stress factors) at various time points.

  • Within-subjects vs. between-subjects design: For yeast studies, researchers typically use between-subjects designs where different yeast strains (e.g., ΔYgl239c vs. wild-type) are compared. This requires careful consideration of genetic background effects and potential compensatory mechanisms.

  • Control selection: Include both positive controls (genes with known functions in related processes) and negative controls (deletion of non-essential genes unrelated to hypothesized YGL239C function).

  • Dependent variable selection: Measure multiple output variables such as growth rate, metabolic profiles, transcriptomic changes, and specific phenotypic markers relevant to hypothesized functions.

For example, in a study examining the effects of YGL239C deletion under different stress conditions, a 3×2 factorial design could be implemented with three levels of stress (none, medium, high) and two strains (wild-type and ΔYgl239c), similar to experimental designs used in other studies .

What bioinformatic approaches can reveal potential functions of YGL239C?

Advanced bioinformatic approaches to reveal potential functions of YGL239C include:

  • Comprehensive sequence analysis: Beyond basic BLAST searches, employ position-specific scoring matrices, hidden Markov models, and sensitive profile-profile alignment methods to detect remote homologs.

  • Structural prediction and analysis: Use AlphaFold2 or RoseTTAFold to predict the 3D structure of YGL239C, followed by structural alignment against known proteins to infer function.

  • Genomic context analysis: Examine gene neighborhood, gene fusion events, and phylogenetic profiling to identify potential functional associations.

  • Protein-protein interaction networks: Construct theoretical interaction networks based on co-expression data, evolutionary conservation, and literature-derived interactions.

  • Comparative genomics: Analyze the presence/absence of YGL239C orthologs across fungal species and correlate with specific phenotypic traits or ecological niches.

These approaches have shown success in annotating hypothetical proteins in various organisms. For instance, implementing a pipeline of computational tools that determine conserved domains, subcellular localization, and physicochemical characteristics has helped identify functions for previously uncharacterized proteins .

What considerations should be made when designing experiments to determine if YGL239C is essential under specific growth conditions?

When designing experiments to assess the essentiality of YGL239C under specific conditions, researchers should consider:

  • Conditional expression systems: Implement tetracycline-regulated or other inducible systems that allow tight control over YGL239C expression levels.

  • High-resolution growth analysis: Use automated systems that measure growth continuously rather than at discrete time points to capture subtle growth defects.

  • Competitive growth assays: Mix wild-type and ΔYgl239c strains (with different markers) and monitor population dynamics over time to detect even small fitness differences.

  • Stress condition matrix: Test a comprehensive matrix of conditions including:

    • Nutrient limitations (carbon, nitrogen, phosphorus)

    • Temperature ranges

    • pH variations

    • Osmotic stress levels

    • Oxidative stress conditions

    • Drug exposures

  • Genetic interaction mapping: Combine YGL239C deletion with deletions of other genes to identify synthetic interactions that may reveal functional relationships.

  • Rescue experiments: Test whether the observed phenotypes can be complemented by reintroducing YGL239C or potential functional homologs from other species.

These approaches ensure a thorough assessment of gene essentiality beyond simple binary (essential/non-essential) classifications, reflecting the context-dependent nature of gene functions .

What protein purification strategies are most effective for recombinant YGL239C expression and isolation?

Effective purification strategies for recombinant YGL239C include:

  • Expression system optimization:

    • Test multiple host strains (BL21(DE3), Rosetta, SHuffle, etc.)

    • Compare various fusion tags (His6, GST, MBP, SUMO)

    • Evaluate induction conditions (temperature, IPTG concentration, duration)

  • Solubility enhancement approaches:

    • Co-expression with chaperones

    • Addition of solubility-enhancing tags (MBP, SUMO, Trx)

    • Expression at lower temperatures (16-18°C)

    • Use of specialized media formulations

  • Purification protocol development:

    StepMethodParametersConsiderations
    Cell lysisSonication or high-pressure homogenizationBuffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerolInclude protease inhibitors
    Initial captureAffinity chromatography (Ni-NTA for His-tagged)Binding buffer: same as lysis; Elution: 250 mM imidazoleMonitor binding efficiency
    Intermediate purificationIon exchange chromatographyBuffer: 20 mM Tris-HCl pH 8.0, 0-1M NaCl gradientSelect based on predicted pI
    PolishingSize exclusion chromatographyBuffer: 20 mM Tris-HCl pH 8.0, 150 mM NaClAnalyze oligomeric state
    Quality controlSDS-PAGE, Western blot, Mass spectrometryN/AVerify purity and identity
  • Protein stability assessment: Perform thermal shift assays to identify buffer conditions that maximize protein stability, which is particularly important for uncharacterized proteins where optimal conditions are unknown.

These approaches take into account the physicochemical properties typically analyzed in uncharacterized proteins, such as instability index, theoretical pI, and GRAVY values, to guide purification strategy development .

How can researchers design functional assays for an uncharacterized protein like YGL239C?

Designing functional assays for an uncharacterized protein requires a systematic approach:

  • Hypothesis generation based on preliminary data:

    • Subcellular localization predictions

    • Structural predictions and domain analysis

    • Co-expression data and genetic interaction networks

    • Phenotypes of deletion mutants

  • Biochemical activity screening:

    • Test for enzymatic activities based on predicted domains

    • Perform substrate screening with compound libraries

    • Assess binding to common cofactors (metals, nucleotides, etc.)

    • Evaluate interaction with cellular components (lipids, nucleic acids)

  • Cellular phenotype assays:

    • Create reporter systems linked to cellular processes

    • Develop high-content imaging assays to detect morphological changes

    • Implement metabolomic profiling to detect metabolic alterations

    • Conduct transcriptomic analysis to identify affected pathways

  • Validation approaches:

    • Structure-guided mutagenesis of predicted functional residues

    • Complementation studies with orthologs from other species

    • Rescue experiments with domain-specific constructs

    • In vivo localization studies with fluorescent tags

Each of these approaches should be designed as controlled experiments with appropriate positive and negative controls. For example, if testing for enzymatic activity, include known enzymes of the same class as positive controls and heat-inactivated samples as negative controls .

What considerations should be made when analyzing contradictory data about YGL239C function?

When faced with contradictory data regarding YGL239C function, researchers should:

  • Systematically evaluate experimental variables:

    • Genetic background differences between yeast strains

    • Variations in experimental conditions (media, temperature, growth phase)

    • Differences in protein expression levels or tagging strategies

    • Technical variations in assay methods or reagents

  • Implement statistical approaches for resolving contradictions:

    • Perform meta-analysis of available data using formal statistical methods

    • Conduct power analysis to determine if negative results are conclusive

    • Employ Bayesian approaches to integrate prior knowledge with new data

    • Use multiple testing correction when evaluating multiple hypotheses

  • Design critical experiments to resolve contradictions:

    • Identify the minimal set of experiments needed to distinguish between competing hypotheses

    • Include controls that specifically address potential sources of variation

    • Use orthogonal methodologies to confirm key findings

    • Collaborate with labs reporting contradictory results to standardize protocols

  • Consider biological complexity:

    • Evaluate the possibility of context-dependent functions

    • Assess potential moonlighting functions in different cellular compartments

    • Investigate condition-specific protein interactions or modifications

    • Consider redundancy and compensatory mechanisms in the yeast genome

This systematic approach to resolving contradictions recognizes that uncharacterized proteins often have complex, context-dependent functions that may not be apparent in all experimental settings .

How can high-throughput technologies be leveraged to elucidate YGL239C function?

High-throughput technologies offer powerful approaches to elucidate YGL239C function:

  • CRISPR-based functional genomics:

    • Genome-wide CRISPR screens in YGL239C deletion or overexpression backgrounds

    • CRISPRi/CRISPRa modulation of gene expression in combination with YGL239C manipulation

    • Base editing approaches for introducing specific mutations in YGL239C

  • Proteomics approaches:

    • Proximity labeling methods (BioID, APEX) to identify physical interactors

    • Thermal proteome profiling to identify ligands or substrates

    • Global protein-protein interaction mapping using yeast two-hybrid or split protein complementation arrays

    • Post-translational modification mapping under various conditions

  • Multi-omics integration:

    • Correlative analysis of transcriptomics, proteomics, and metabolomics data

    • Network-based approaches to position YGL239C in cellular pathways

    • Machine learning models to predict function from integrated datasets

  • Single-cell approaches:

    • Single-cell transcriptomics to detect cell-to-cell variation in responses

    • Microfluidics-based phenotypic profiling at single-cell resolution

    • Live-cell imaging with advanced microscopy to track protein dynamics

These approaches can generate comprehensive datasets that, when properly integrated, can reveal functional associations and mechanistic insights that might not be apparent from more targeted studies .

What are the best practices for publishing research on uncharacterized proteins like YGL239C?

When publishing research on uncharacterized proteins like YGL239C, researchers should follow these best practices:

  • Nomenclature and identification:

    • Provide complete gene and protein identifiers (SGD ID, UniProt ID)

    • Include amino acid sequence or reference to the specific sequence studied

    • Clearly indicate any modifications (tags, mutations) to the native sequence

  • Experimental reporting standards:

    • Describe yeast strains, including genetic background and verification methods

    • Detail growth conditions precisely (media composition, temperature, growth phase)

    • Provide complete methods for protein expression and purification

    • Include all control experiments and their results

  • Data presentation and availability:

    • Present both positive and negative findings

    • Include statistical analysis and justification of sample sizes

    • Deposit raw data in appropriate repositories (e.g., proteomics data in PRIDE)

    • Share materials through repositories like Addgene for plasmids

  • Interpretation guidelines:

    • Clearly distinguish between direct experimental evidence and inference

    • Discuss alternative interpretations of the data

    • Place findings in context of existing literature on S. cerevisiae

    • Suggest specific follow-up experiments for future research

Following these practices ensures that research on uncharacterized proteins contributes meaningfully to the scientific community's understanding and facilitates future work building on the published findings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.