Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR069W (YGR069W)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YGR069W

Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YGR069W (YGR069W) is a synthetic version of the yeast protein encoded by the YGR069W gene. Despite being conserved in yeast genomes, its biological role remains uncharacterized, with limited functional studies available. The recombinant form is engineered for research applications, typically produced in E. coli and modified with affinity tags (e.g., His-tag) to facilitate purification .

Functional Insights and Research Gaps

While YGR069W itself lacks direct functional characterization, its paralog YER067W (now designated RGI1) has been studied:

  • Stress Response: YER067W is induced under stress conditions (e.g., heat shock, oxidative stress) and regulates carbohydrate metabolism (glycogen/trehalose balance) .

  • Energy Metabolism: Deletion mutants of YER067W show impaired aerobic growth and mitochondrial dysfunction .

YGR069W shares sequence homology with YER067W but has no documented functional overlap. Current hypotheses suggest potential roles in stress adaptation or metabolic regulation, though experimental validation is pending .

Research Challenges and Future Directions

  1. Functional Elucidation: No direct biochemical assays or genetic screens have been reported for YGR069W.

  2. Localization: Unlike YER067W (mitochondria-associated), YGR069W’s subcellular localization remains unconfirmed .

  3. Structural Analysis: AlphaFold predictions or crystallographic data are unavailable in public databases .

Comparative Analysis with Paralog YER067W (RGI1)

FeatureYGR069WYER067W (RGI1)
Gene ExpressionUnstudiedStress-induced, metabolism-linked
Subcellular RoleUnknownMitochondrial function inferred
Carbohydrate MetabolismNo dataRegulates glycogen/trehalose balance
Commercial ReagentsLimited antibody availability No reported recombinant variants

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
YGR069W; Putative uncharacterized protein YGR069W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGR069W
Target Protein Sequence
MVLLHPILAESCTRYFLLLPSYTHPNHLFHFPSISFFFFFFFFFFSFRRNCLFRIVKDEV KYSGVYYYIHTKQDKETFLDLTFYFNCFCIPYNKKDLLFNVGVIRPLLDLQ
Uniprot No.

Target Background

Database Links

STRING: 4932.YGR069W

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YGR069W and why is it significant for yeast research?

YGR069W is a putative uncharacterized protein in Saccharomyces cerevisiae with a full length of 111 amino acids. It belongs to the category of proteins that have been systematically identified but lack detailed functional characterization. The significance of studying this protein lies in expanding our understanding of the yeast proteome and potentially uncovering novel cellular functions.

Methodological approach: To establish the significance of YGR069W, researchers should conduct comparative genomic analyses across related yeast species to determine conservation patterns. Additionally, analyzing its expression under various growth conditions using RT-qPCR or RNA-seq can provide insights into its potential physiological roles .

What expression systems are available for recombinant YGR069W production?

The protein is currently available as a recombinant full-length product expressed in E. coli with a His-tag. The full-length protein spans amino acids 1-111, making it relatively small and potentially amenable to various expression systems .

Methodological approach: For optimal expression, researchers should consider:

  • Prokaryotic systems: E. coli BL21(DE3) with pET vectors incorporating a His-tag for purification

  • Eukaryotic systems: Native expression in S. cerevisiae using GAL1 promoter-driven vectors

  • Cell-free systems: When protein toxicity is a concern

The choice depends on research goals - bacterial systems offer high yield but may lack proper folding, while yeast expression provides proper post-translational modifications.

How can researchers verify the identity and purity of recombinant YGR069W?

Methodological approach: A multi-faceted verification strategy should include:

  • SDS-PAGE analysis to confirm molecular weight (expected ~12-15 kDa including the His-tag)

  • Western blotting using anti-His antibodies

  • Mass spectrometry analysis for peptide fingerprinting

  • Circular dichroism to assess secondary structure integrity

Verification MethodExpected ResultAdvantagesLimitations
SDS-PAGE~12-15 kDa bandQuick, accessibleLimited specificity
Western blotSingle band at expected MWHigh specificityRequires antibodies
Mass spectrometryPeptide matches to YGR069W sequenceDefinitive identificationTechnical complexity
CD spectroscopySecondary structure profileStructural informationRequires pure protein

How can researchers determine if YGR069W associates with ribosomal complexes?

Based on systematic screens of yeast ribosomal complexes, several previously uncharacterized proteins have been found to associate with ribosomes. To investigate if YGR069W has similar associations, researchers should employ multiple complementary approaches.

Methodological approach:

  • Sucrose gradient fractionation (SGF) to separate ribosomal complexes (40S, 60S, 80S, and polysomes)

  • Mass spectrometry analysis of each fraction to detect YGR069W

  • Immunoblotting of gradient fractions using tagged YGR069W

  • EDTA-dependent cosedimentation assays, as many ribosome-associated proteins show EDTA-sensitive interactions

For SGF experiments, researchers should perform multiple independent purifications (minimum of 9 for 40S, 60S, and 80S; 5 for polysomes) and include appropriate controls like RPL3 and ASC1 for ribosomal fractions and CDC28 (PSTAIR) for non-ribosomal fractions .

What techniques are most effective for identifying protein interaction partners of YGR069W?

Understanding protein interaction networks is crucial for functional characterization of uncharacterized proteins like YGR069W.

Methodological approach:

  • Tandem Affinity Purification (TAP) followed by mass spectrometry

    • Create a TAP-tagged YGR069W strain

    • Calculate Purification Abundance Factors (PAFs) and Relative Abundance Factors (RAFs) to identify strong interactions

    • Validate by reciprocal TAP of identified partners

  • Yeast two-hybrid screening

    • Use YGR069W as both bait and prey

    • Include controls to eliminate false positives

  • Proximity-dependent biotin identification (BioID)

    • Fuse YGR069W to a biotin ligase

    • Identify proteins that become biotinylated due to proximity

When analyzing interaction data, researchers should focus on proteins with PAFs at least 10-fold higher than background and validate these interactions through reciprocal experiments .

How can CRISPR-Cas9 genome editing be applied to study YGR069W function?

CRISPR-Cas9 has revolutionized genome editing in S. cerevisiae and can be effectively used to study YGR069W.

Methodological approach:

  • Gene knockout studies:

    • Design sgRNAs targeting YGR069W

    • Introduce Cas9 and sgRNA expression cassettes

    • Include repair templates with selection markers

    • Verify deletions by PCR and sequencing

    • Perform phenotypic analysis under various conditions

  • Tagging for localization studies:

    • Design sgRNAs targeting the C-terminus

    • Include repair templates with fluorescent protein coding sequences

    • Monitor cellular localization under different conditions

  • Promoter replacement for controlled expression:

    • Target the native promoter region

    • Include inducible promoter (like GAL1) in repair template

    • Study effects of controlled expression

The CRISPR-Cas9 system offers advantages over traditional methods by being more efficient and less time-consuming for creating genetically modified S. cerevisiae strains .

What are the best approaches for analyzing the subcellular localization of YGR069W?

Understanding where YGR069W localizes within the cell can provide significant insights into its function.

Methodological approach:

  • Fluorescent protein tagging:

    • C-terminal fusion with GFP or mCherry

    • Live-cell imaging under various growth conditions

    • Co-localization studies with known organelle markers

  • Subcellular fractionation:

    • Separate cellular components through differential centrifugation

    • Detect YGR069W by Western blotting in different fractions

    • Compare with marker proteins for each compartment

  • Immunogold electron microscopy:

    • Use antibodies against tagged YGR069W

    • Visualize at ultrastructural level

  • Ghost cell preparation:

    • Apply Sponge-Like re-reduced protocol adapted for yeast

    • Maintain cellular architecture while extracting cytoplasmic contents

    • Detect whether YGR069W remains associated with cellular structures

For yeast ghost preparation, researchers should note that traditional protocols require modification. Unlike bacterial cells, yeast cells should be processed using decantation rather than centrifugation to avoid self-adhering or shrinking of empty cells .

How should researchers analyze mass spectrometry data for YGR069W-associated complexes?

Mass spectrometry is a powerful tool for identifying proteins in complex mixtures, but data analysis requires careful consideration.

Methodological approach:

  • Establish experimental controls:

    • Include non-specific binding controls (e.g., untagged strains)

    • Perform biological replicates (minimum 3)

  • Data filtering criteria:

    • For ribosomal association studies, include proteins identified in ≥3 experiments for 40S, 60S, and 80S fractions

    • For polysome association, include proteins identified in ≥2 experiments

  • Calculate enrichment scores:

    • Purification Abundance Factor (PAF): total peptides identified

    • Relative Abundance Factor (RAF): enrichment relative to control samples

  • Validation strategy:

    • Confirm by orthogonal methods (e.g., Western blotting)

    • Perform reciprocal purifications of identified partners

What statistical approaches are most appropriate for analyzing YGR069W deletion phenotypes?

When analyzing phenotypic data from YGR069W deletion strains, robust statistical methods are essential.

Methodological approach:

  • Experimental design considerations:

    • Include multiple biological replicates (minimum 5)

    • Test multiple environmental conditions

    • Include appropriate control strains (wild-type and deletions of related genes)

  • Statistical tests by data type:

    • Growth rate data: ANOVA with post-hoc tests

    • Survival assays: Log-rank test for time-course data

    • Gene expression: DESeq2 or similar tools for RNA-seq data

  • Multiple hypothesis correction:

    • Apply Benjamini-Hochberg procedure to control false discovery rate

    • Consider p-value adjustment when testing multiple conditions

  • Data visualization:

    • Principal component analysis for multivariate data

    • Heatmaps for expression patterns across conditions

    • Growth curves with error bars representing biological variation

How can researchers distinguish between direct and indirect effects of YGR069W deletion?

Distinguishing direct from indirect effects remains a significant challenge in functional genomics.

Methodological approach:

  • Temporal analysis:

    • Use time-course experiments to identify immediate vs. delayed effects

    • Employ inducible expression systems for rapid depletion studies

  • Epistasis analysis:

    • Generate double mutants with genes in related pathways

    • Analyze genetic interactions through growth phenotyping

  • Physical interaction validation:

    • Perform in vitro binding assays with purified components

    • Use BiFC (Bimolecular Fluorescence Complementation) to confirm interactions in vivo

  • Rescue experiments:

    • Test complementation with wild-type YGR069W

    • Test complementation with mutant versions lacking specific domains

What are the challenges in detecting low-abundance proteins like YGR069W in proteomic studies?

Uncharacterized proteins often exist at low abundance, presenting challenges for detection.

Methodological approach:

  • Sample preparation optimization:

    • Employ fractionation techniques to reduce sample complexity

    • Use affinity enrichment to concentrate the protein of interest

  • Mass spectrometry considerations:

    • Implement data-independent acquisition (DIA) for improved sensitivity

    • Use targeted approaches like Selected Reaction Monitoring (SRM)

  • Data analysis strategies:

    • Apply advanced peak detection algorithms

    • Use stringent filtering to distinguish signal from noise

  • Validation with orthogonal methods:

    • Western blotting with increased sample loading

    • qPCR to confirm gene expression at the transcript level

How can comparative genomics inform functional predictions for YGR069W?

Evolutionary conservation patterns can provide valuable insights into protein function.

Methodological approach:

  • Homology identification:

    • BLAST searches against diverse fungal genomes

    • Profile-based methods (HMMs) for distant homolog detection

  • Sequence conservation analysis:

    • Multiple sequence alignment of homologs

    • Identification of conserved domains and motifs

  • Synteny analysis:

    • Examine conservation of genomic context across species

    • Identify co-evolved gene clusters

  • Integrated analysis:

    • Correlate conservation patterns with known phenotypic data

    • Use protein structure prediction (AlphaFold) to identify functional sites

What emerging technologies show promise for characterizing proteins like YGR069W?

Several cutting-edge technologies are becoming increasingly valuable for studying uncharacterized proteins.

Methodological approach:

  • Single-cell proteomics:

    • Analyze YGR069W expression at single-cell resolution

    • Identify cell-to-cell variability in protein levels and localization

  • Cryo-electron microscopy:

    • Determine high-resolution structures of YGR069W complexes

    • Visualize interactions with binding partners

  • Proximity labeling techniques:

    • APEX2 or TurboID fusions for in vivo proximity mapping

    • Identify transient or weak interactions missed by traditional methods

  • Protein structure prediction:

    • Use AlphaFold2 to generate structural models

    • Guide hypothesis generation for structure-function relationships

How might understanding YGR069W contribute to broader knowledge of yeast biology?

Characterizing uncharacterized proteins contributes significantly to our understanding of cellular systems.

Methodological approach:

  • Systems biology integration:

    • Incorporate YGR069W functional data into existing network models

    • Identify emergent properties from network analysis

  • Evolutionary context:

    • Compare function across diverse yeast species

    • Identify species-specific adaptations vs. conserved functions

  • Industrial applications:

    • Explore potential biotechnological applications based on function

    • Consider metabolic engineering implications

  • Model organism relevance:

    • Identify human homologs if present

    • Establish relevance to understanding conserved eukaryotic processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.