Name: Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR114C (YGR114C)
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c), also known as Baker's yeast
The amino acid sequence of YGR114C is as follows :
MFSSFFGNTCSWVFIFIIIVDNEAFLHFSCLIFVFINIFVFLRGVKDIFSFFFLTRRFSFIVVIYYFFLVPRDQLRISRLFHKRQILCKDSRQLMTCSLGLFFKAQINIFLPPFALTVVQFLVNLVCHT
YGR114C is produced using an in vitro E. coli expression system .
The expressed region spans the full length of the protein (1-129 amino acids) .
As a "putative uncharacterized protein," the precise function of YGR114C remains unknown . Research indicates that many proteins in S. cerevisiae have been identified and cataloged to understand protein-protein interactions . Genomic databases like NCBI's Gene Expression Omnibus (GEO) provide gene expression data that might be relevant to understanding the function of YGR114C . Chemical-genetic profile analysis in yeast suggests that a previously uncharacterized open reading frame, YBR261C, affects protein synthesis .
One study of S. cerevisiae found that the genes HAL3 and VHS3 can perform different functions in the cell. They can regulate a protein phosphatase involved in saline tolerance and in the cell cycle. The proteins coded by HAL3 and VHS3 are capable of carrying out completely different functions in the cell .
Recombinant YGR114C can be produced through heterologous expression in E. coli using standard molecular cloning techniques. The process involves:
PCR amplification of the YGR114C gene (ORF) from S. cerevisiae genomic DNA using specific primers
Cloning into an expression vector with an N-terminal His-tag
Transformation into competent E. coli cells
Induction of protein expression
Purification using nickel affinity chromatography
Lyophilization for storage
The purified protein typically has >90% purity as determined by SDS-PAGE. For optimal storage, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol and store at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles .
Based on available research protocols, the following conditions are recommended:
| Parameter | Recommended Condition |
|---|---|
| Storage buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Deionized sterile water to 0.1-1.0 mg/mL |
| Storage | -20°C/-80°C with 50% glycerol |
| Working temperature | 4°C for up to one week |
| Freeze-thaw cycles | Minimize, use aliquots |
Prior to use, centrifuge the vial briefly to bring contents to the bottom. Avoid repeated freeze-thaw cycles as this may affect protein integrity and activity .
To investigate the function of this uncharacterized protein, a multi-faceted approach is recommended:
Genomic Context Analysis: Examine the chromosomal location and neighboring genes for potential functional relationships.
Phenotypic Screening: Create knockout strains (ΔYGR114C) and assess phenotypes under various conditions using the ExpDes R package for experimental design and ANOVA . Completely Randomized Design (CRD) or Randomized Blocks Design (RBD) are appropriate for these experiments.
Synthetic Genetic Array (SGA) Analysis: Cross ΔYGR114C with a library of yeast deletion strains to identify genetic interactions, which can reveal functional relationships .
High-throughput Transformation Approach: As an alternative to SGA, transform a library of yeast strains with a YGR114C deletion cassette using high-throughput transformation methods :
Use the SFH (short flanking homology) method with 45-60nt homology regions
Utilize liquid handling robotic systems to transform 1200 strains per day
Select transformants using appropriate markers
Localization Studies: Express YGR114C fused to a fluorescent protein to determine subcellular localization.
Transcriptomic and Proteomic Analyses: Compare wild-type and ΔYGR114C strains to identify affected pathways.
Each approach provides complementary information about YGR114C function, with experimental designs tailored to specific research questions .
For robust statistical analysis of YGR114C phenotypic data, consider the following approaches:
ANOVA for Experimental Designs: Use the ExpDes R package which handles balanced experiments under fixed models. Different functions are available depending on your experimental design:
crd() for completely randomized designs
rbd() for randomized block designs
fat2.crd() or fat2.rbd() for factorial designs with 2 factors
Normality Testing: Verify the normality of residuals using the Shapiro-Wilk test, which is automatically performed by the ExpDes package functions .
These statistical approaches will ensure robust analysis of phenotypic data and proper interpretation of YGR114C's functional characteristics.
For efficient generation of YGR114C knockout strains, two primary methods are recommended:
Lithium Acetate Transformation with Homologous Recombination:
Amplify a deletion cassette (e.g., KanMX4) with primers containing 45-60bp homology to regions flanking YGR114C
Transform using the optimized high-throughput lithium acetate method:
Grow cells to OD600 of 0.7-1.0
Incubate with transformation mix (PEG, lithium acetate, carrier DNA)
Heat shock at 42°C for 40 minutes
Select transformants on appropriate media (e.g., YPD + G418 for KanMX4)
This method can be adapted for robotic liquid handling systems, allowing transformation of 1200 strains daily .
CRISPR-Cas9 Based Deletion:
The efficiency of correct integration reaches approximately 90% with 60bp homology regions, making this approach highly reliable for YGR114C deletion .
CRISPR interference (CRISPRi) offers a powerful approach to study YGR114C function through transcriptional repression rather than complete deletion:
CRISPRi System Components:
Express catalytically inactive Cas9 (dCas9) containing D10A and H840A mutations
Design sgRNA with a 20bp sequence complementary to YGR114C
Target Site Selection for Optimal Repression:
For maximum repression, target the non-template strand of YGR114C near the transcription start site
Include the required NGG PAM sequence
Repression efficiency is inversely correlated with distance from the transcription start site
Experimental Design:
Co-express dCas9 and sgRNA targeting YGR114C
Include controls: truncated sgRNA lacking the base-pairing region but containing the dCas9-binding hairpin
Monitor repression using qPCR or reporter systems
Expected Outcomes:
This method allows for temporal control of YGR114C expression by regulating dCas9 and sgRNA expression, providing insights into the protein's function during different cellular processes.
To comprehensively map genetic interactions of YGR114C, consider these advanced approaches:
Saturated Transposition Analysis (SATAY):
Generate a library of transposon insertion mutants in a wild-type or YGR114C-mutant background
Sequence the insertion sites and quantify read counts
Compare insertion profiles between conditions to identify genetic interactions
This method can reveal both positive and negative genetic interactions with YGR114C
Systematic Genetic Array (SGA) Analysis:
Create a query strain with YGR114C deletion or modification
Cross with the yeast deletion library (~5,000 strains)
Generate double mutants through a series of selection steps
Analyze growth phenotypes to identify interactions
High-Throughput Transformation Alternative to SGA:
Computational Analysis of Interaction Data:
These approaches provide complementary data to construct a comprehensive map of YGR114C genetic interactions, revealing its functional role in cellular processes.
Advanced bioinformatic approaches can provide insights into YGR114C's function despite its uncharacterized status:
Z-Curve Analysis for Coding Probability:
Chromatin State Analysis:
Structural Prediction and Protein Family Assignment:
Use comparative modeling and protein family databases to identify potential domains
Analyze hydrophobicity patterns to predict membrane association
Apply machine learning algorithms to predict function from sequence features
Evolutionary Conservation Analysis:
These computational approaches provide testable hypotheses about YGR114C function that can guide experimental design and interpretation.
While YGR114C is not currently known to be used in vaccine development, S. cerevisiae has been successfully employed as a vaccine vehicle. For researchers interested in exploring YGR114C in this context:
Recombinant Expression Optimization:
Immunological Response Assessment:
S. cerevisiae can induce maturation of dendritic cells (DCs)
Yeast-expressed proteins can be presented via both MHC class I and II pathways
Test if YGR114C-expressing yeast induces antigen-specific T-cell responses in vitro:
Expression Vector Design:
Vaccination Protocols:
These approaches allow exploration of YGR114C as both a potential antigen and a component of yeast-based vaccine platforms.
Researchers commonly encounter several challenges when working with recombinant YGR114C:
Additional troubleshooting recommendations:
Verify protein integrity by mass spectrometry
Test different E. coli expression strains (BL21, Rosetta, etc.)
Consider native purification from S. cerevisiae for proper post-translational modifications
For membrane-associated proteins like YGR114C, consider specialized detergent-based extraction methods
When encountering contradictory results in YGR114C studies across different experimental setups:
Systematic Experimental Design Analysis:
Growth Condition Standardization:
Statistical Validation Approaches:
Data Integration Methods:
Genetic Background Verification:
These approaches help resolve inconsistencies and ensure reproducible findings in YGR114C research.
Several cutting-edge technologies hold promise for elucidating YGR114C function:
Next-Generation Functional Genomics:
Advanced CRISPR Applications:
Single-Cell Transcriptomics:
Analyze cell-to-cell variability in YGR114C expression
Identify subpopulations with distinct responses to YGR114C manipulation
Study temporal dynamics of gene expression changes
Integrative Computational Approaches:
Structural Biology Innovations:
Cryo-electron microscopy for membrane protein structures
Hydrogen-deuterium exchange mass spectrometry for protein dynamics
AlphaFold2 and other AI-based structure prediction tools
These technologies provide complementary approaches to unravel YGR114C's biological role and could lead to significant advancements in our understanding of this uncharacterized protein.
Comprehensive phenotypic characterization of YGR114C can contribute to broader understanding of yeast biology in several ways:
Mapping the Phenotypic Landscape:
Genetic Architecture Insights:
Stress Response Mechanisms:
Evolutionary Biology Applications:
Analysis of YGR114C conservation across yeast strains and species
Identification of selection pressures on specific protein domains
Understanding how uncharacterized proteins contribute to phenotypic diversity
This comprehensive approach positions YGR114C research within the broader context of systems biology, potentially revealing fundamental principles of cellular organization and adaptation.