Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR114C (YGR114C)

Shipped with Ice Packs
In Stock

Description

General Information

  • Name: Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR114C (YGR114C)

  • Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c), also known as Baker's yeast

  • UniProt Accession Number: P53268

  • Product Type: Transmembrane Protein

Sequence

The amino acid sequence of YGR114C is as follows :

MFSSFFGNTCSWVFIFIIIVDNEAFLHFSCLIFVFINIFVFLRGVKDIFSFFFLTRRFSFIVVIYYFFLVPRDQLRISRLFHKRQILCKDSRQLMTCSLGLFFKAQINIFLPPFALTVVQFLVNLVCHT

Production

  • YGR114C is produced using an in vitro E. coli expression system .

  • The protein includes an N-terminal 10xHis-tag .

  • The expressed region spans the full length of the protein (1-129 amino acids) .

Function and Research

As a "putative uncharacterized protein," the precise function of YGR114C remains unknown . Research indicates that many proteins in S. cerevisiae have been identified and cataloged to understand protein-protein interactions . Genomic databases like NCBI's Gene Expression Omnibus (GEO) provide gene expression data that might be relevant to understanding the function of YGR114C . Chemical-genetic profile analysis in yeast suggests that a previously uncharacterized open reading frame, YBR261C, affects protein synthesis .

One study of S. cerevisiae found that the genes HAL3 and VHS3 can perform different functions in the cell. They can regulate a protein phosphatase involved in saline tolerance and in the cell cycle. The proteins coded by HAL3 and VHS3 are capable of carrying out completely different functions in the cell .

Product Specs

Form
Supplied as a lyophilized powder.
Note: We will ship the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on shipping method and location. Please contact your local distributor for estimated delivery times.
Note: Our proteins are shipped on blue ice. Dry ice shipping is available upon request and incurs additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted according to customer needs.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
YGR114C; G6163; Putative uncharacterized protein YGR114C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGR114C
Target Protein Sequence
MFSSFFGNTCSWVFIFIIIVDNEAFLHFSCLIFVFINIFVFLRGVKDIFSFFFLTRRFSF IVVIYYFFLVPRDQLRISRLFHKRQILCKDSRQLMTCSLGLFFKAQINIFLPPFALTVVQ FLVNLVCHT
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How can I obtain recombinant YGR114C protein for my research?

Recombinant YGR114C can be produced through heterologous expression in E. coli using standard molecular cloning techniques. The process involves:

  • PCR amplification of the YGR114C gene (ORF) from S. cerevisiae genomic DNA using specific primers

  • Cloning into an expression vector with an N-terminal His-tag

  • Transformation into competent E. coli cells

  • Induction of protein expression

  • Purification using nickel affinity chromatography

  • Lyophilization for storage

The purified protein typically has >90% purity as determined by SDS-PAGE. For optimal storage, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol and store at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles .

What are the recommended experimental conditions for handling recombinant YGR114C?

Based on available research protocols, the following conditions are recommended:

ParameterRecommended Condition
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Storage-20°C/-80°C with 50% glycerol
Working temperature4°C for up to one week
Freeze-thaw cyclesMinimize, use aliquots

Prior to use, centrifuge the vial briefly to bring contents to the bottom. Avoid repeated freeze-thaw cycles as this may affect protein integrity and activity .

How can I design experiments to determine the function of YGR114C?

To investigate the function of this uncharacterized protein, a multi-faceted approach is recommended:

  • Genomic Context Analysis: Examine the chromosomal location and neighboring genes for potential functional relationships.

  • Phenotypic Screening: Create knockout strains (ΔYGR114C) and assess phenotypes under various conditions using the ExpDes R package for experimental design and ANOVA . Completely Randomized Design (CRD) or Randomized Blocks Design (RBD) are appropriate for these experiments.

  • Synthetic Genetic Array (SGA) Analysis: Cross ΔYGR114C with a library of yeast deletion strains to identify genetic interactions, which can reveal functional relationships .

  • High-throughput Transformation Approach: As an alternative to SGA, transform a library of yeast strains with a YGR114C deletion cassette using high-throughput transformation methods :

    • Use the SFH (short flanking homology) method with 45-60nt homology regions

    • Utilize liquid handling robotic systems to transform 1200 strains per day

    • Select transformants using appropriate markers

  • Localization Studies: Express YGR114C fused to a fluorescent protein to determine subcellular localization.

  • Transcriptomic and Proteomic Analyses: Compare wild-type and ΔYGR114C strains to identify affected pathways.

Each approach provides complementary information about YGR114C function, with experimental designs tailored to specific research questions .

What statistical approaches should I use to analyze phenotypic data from YGR114C studies?

For robust statistical analysis of YGR114C phenotypic data, consider the following approaches:

  • ANOVA for Experimental Designs: Use the ExpDes R package which handles balanced experiments under fixed models. Different functions are available depending on your experimental design:

    • crd() for completely randomized designs

    • rbd() for randomized block designs

    • fat2.crd() or fat2.rbd() for factorial designs with 2 factors

  • Normality Testing: Verify the normality of residuals using the Shapiro-Wilk test, which is automatically performed by the ExpDes package functions .

These statistical approaches will ensure robust analysis of phenotypic data and proper interpretation of YGR114C's functional characteristics.

What is the most efficient method for generating YGR114C knockout strains?

For efficient generation of YGR114C knockout strains, two primary methods are recommended:

  • Lithium Acetate Transformation with Homologous Recombination:

    • Amplify a deletion cassette (e.g., KanMX4) with primers containing 45-60bp homology to regions flanking YGR114C

    • Transform using the optimized high-throughput lithium acetate method:

      • Grow cells to OD600 of 0.7-1.0

      • Incubate with transformation mix (PEG, lithium acetate, carrier DNA)

      • Heat shock at 42°C for 40 minutes

      • Select transformants on appropriate media (e.g., YPD + G418 for KanMX4)

    This method can be adapted for robotic liquid handling systems, allowing transformation of 1200 strains daily .

  • CRISPR-Cas9 Based Deletion:

    • Assemble the sgRNA into a suitable vector (e.g., pWS174) using Golden Gate assembly

    • Co-transform with a Cas9-expressing plasmid and a repair template

    • Select transformants and verify by PCR and sequencing

The efficiency of correct integration reaches approximately 90% with 60bp homology regions, making this approach highly reliable for YGR114C deletion .

How can I use CRISPRi for studying YGR114C function without completely deleting the gene?

CRISPR interference (CRISPRi) offers a powerful approach to study YGR114C function through transcriptional repression rather than complete deletion:

  • CRISPRi System Components:

    • Express catalytically inactive Cas9 (dCas9) containing D10A and H840A mutations

    • Design sgRNA with a 20bp sequence complementary to YGR114C

  • Target Site Selection for Optimal Repression:

    • For maximum repression, target the non-template strand of YGR114C near the transcription start site

    • Include the required NGG PAM sequence

    • Repression efficiency is inversely correlated with distance from the transcription start site

  • Experimental Design:

    • Co-express dCas9 and sgRNA targeting YGR114C

    • Include controls: truncated sgRNA lacking the base-pairing region but containing the dCas9-binding hairpin

    • Monitor repression using qPCR or reporter systems

  • Expected Outcomes:

    • Up to 99.9% repression of YGR114C expression

    • Ability to create partial loss-of-function phenotypes

    • Opportunity to study essential domains without lethality

This method allows for temporal control of YGR114C expression by regulating dCas9 and sgRNA expression, providing insights into the protein's function during different cellular processes.

How can I identify genetic interactions involving YGR114C using high-throughput methods?

To comprehensively map genetic interactions of YGR114C, consider these advanced approaches:

  • Saturated Transposition Analysis (SATAY):

    • Generate a library of transposon insertion mutants in a wild-type or YGR114C-mutant background

    • Sequence the insertion sites and quantify read counts

    • Compare insertion profiles between conditions to identify genetic interactions

    • This method can reveal both positive and negative genetic interactions with YGR114C

  • Systematic Genetic Array (SGA) Analysis:

    • Create a query strain with YGR114C deletion or modification

    • Cross with the yeast deletion library (~5,000 strains)

    • Generate double mutants through a series of selection steps

    • Analyze growth phenotypes to identify interactions

  • High-Throughput Transformation Alternative to SGA:

    • Transform the yeast deletion library with a YGR114C deletion/modification construct

    • More efficient than SGA, requiring only 6 days to transform the entire library

    • Uses significantly fewer consumables (14 racks of P200 and 12 racks of P50 tips for 12 plates)

  • Computational Analysis of Interaction Data:

    • Apply a Personalized Page Rank (PPR) algorithm to track signal expansion through an interactome

    • Identify pleiotropic gene modules that may share functions with YGR114C

    • Look for modules with >75% genes in common between traits

These approaches provide complementary data to construct a comprehensive map of YGR114C genetic interactions, revealing its functional role in cellular processes.

What bioinformatic methods can predict functional domains and potential roles of YGR114C?

Advanced bioinformatic approaches can provide insights into YGR114C's function despite its uncharacterized status:

  • Z-Curve Analysis for Coding Probability:

    • Calculate the YZ score for YGR114C to assess its coding potential

    • This approach achieves >95% accuracy in identifying true protein-coding genes in yeast

    • YZ scores incorporate multiple sequence features beyond traditional codon bias indices (CBI or CAI)

  • Chromatin State Analysis:

    • Examine promoter characteristics of YGR114C, including:

      • DNaseI hypersensitivity

      • CpG and GC content

      • Histone modification patterns (H4K16ac, H3K4me2, H3K27ac)

    • These features can predict expression regulation patterns

  • Structural Prediction and Protein Family Assignment:

    • Use comparative modeling and protein family databases to identify potential domains

    • Analyze hydrophobicity patterns to predict membrane association

    • Apply machine learning algorithms to predict function from sequence features

  • Evolutionary Conservation Analysis:

    • Examine YGR114C conservation across different yeast species and strains

    • Identify conserved regions that might indicate functional domains

    • Analyze selection pressure using dN/dS ratios to identify constrained regions

These computational approaches provide testable hypotheses about YGR114C function that can guide experimental design and interpretation.

How can I use recombinant YGR114C for immunological studies and potential vaccine development?

While YGR114C is not currently known to be used in vaccine development, S. cerevisiae has been successfully employed as a vaccine vehicle. For researchers interested in exploring YGR114C in this context:

  • Recombinant Expression Optimization:

    • Express YGR114C under a constitutive promoter (e.g., TEF2) rather than an inducible one

    • Use high-copy 2μm expression plasmids like pGI-100

    • Include appropriate purification tags (His-tag) for downstream applications

  • Immunological Response Assessment:

    • S. cerevisiae can induce maturation of dendritic cells (DCs)

    • Yeast-expressed proteins can be presented via both MHC class I and II pathways

    • Test if YGR114C-expressing yeast induces antigen-specific T-cell responses in vitro:

      • CD4+ T-cell responses (helper T cells)

      • CD8+ T-cell responses (cytotoxic T cells)

  • Expression Vector Design:

    • Forward primer design: 5'-CGGAATTC[ATG start codon][YGR114C sequence]-3'

    • Reverse primer design: 5'-ATAAGAATGCGGCCGCTA[His-tag sequence][YGR114C end]-3'

    • Verify expression by Western blot using anti-His antibodies

  • Vaccination Protocols:

    • Multiple site administration may induce greater immune responses

    • Repeated vaccinations can increase antigen-specific T-cell responses

    • Monitor immune responses through ELISpot or flow cytometry

These approaches allow exploration of YGR114C as both a potential antigen and a component of yeast-based vaccine platforms.

What are common issues in expressing and purifying recombinant YGR114C and how can they be resolved?

Researchers commonly encounter several challenges when working with recombinant YGR114C:

IssuePossible CausesSolutions
Low expression yieldCodon usage bias in E. coliUse codon-optimized sequence or expression in yeast hosts
Toxicity to host cellsUse tightly controlled inducible promoters or lower induction temperatures
Protein degradationAdd protease inhibitors; express with fusion partners
Insoluble proteinHydrophobic regions leading to aggregationUse detergents; optimize solubilization conditions
Incorrect foldingExpress at lower temperatures (16-25°C); add folding enhancers
Impurity in preparationsNon-specific binding to purification resinIncrease imidazole in wash buffers; use two-step purification
Loss of activity after storageProtein instabilityAdd stabilizing agents like trehalose (6%) to storage buffer
Aggregation during freeze-thawAdd 50% glycerol; store in small aliquots

Additional troubleshooting recommendations:

  • Verify protein integrity by mass spectrometry

  • Test different E. coli expression strains (BL21, Rosetta, etc.)

  • Consider native purification from S. cerevisiae for proper post-translational modifications

  • For membrane-associated proteins like YGR114C, consider specialized detergent-based extraction methods

How can I resolve data inconsistencies when studying YGR114C phenotypes across different experimental designs?

When encountering contradictory results in YGR114C studies across different experimental setups:

  • Systematic Experimental Design Analysis:

    • Verify that the appropriate design was used for each experiment (CRD, RBD, Latin Square)

  • Growth Condition Standardization:

    • Ensure consistent media composition across experiments

    • Standardize growth parameters (temperature, pH, agitation)

    • For continuous culture experiments, maintain consistent:

      • Dilution rate (D = 0.2 h-1)

      • pH (3.3)

      • Temperature (28°C)

      • Stirring (300 rpm)

  • Statistical Validation Approaches:

    • Perform meta-analysis of multiple experiments

    • Use appropriate statistical tests for each experimental design

    • Apply Cochran's test for homogeneity of variances across experiments

  • Data Integration Methods:

    • Identify sources of variability through principal component analysis

  • Genetic Background Verification:

    • Confirm genotypes through PCR and sequencing

    • Check for suppressor mutations that might have arisen during strain construction

    • Consider the impact of strain background on YGR114C function

These approaches help resolve inconsistencies and ensure reproducible findings in YGR114C research.

What emerging technologies could advance our understanding of YGR114C function?

Several cutting-edge technologies hold promise for elucidating YGR114C function:

  • Next-Generation Functional Genomics:

    • SATAY (Saturated Transposition) for high-resolution functional mapping:

      • Can identify not only essential genes but also essential protein domains

      • Generates both null and other informative alleles

      • Can reveal drug targets and genetic interactions

  • Advanced CRISPR Applications:

    • CRISPRi with multiple sgRNAs for studying interaction networks

    • CRISPRa (activation) to explore gain-of-function phenotypes

    • Base editing for precise mutagenesis without double-strand breaks

  • Single-Cell Transcriptomics:

    • Analyze cell-to-cell variability in YGR114C expression

    • Identify subpopulations with distinct responses to YGR114C manipulation

    • Study temporal dynamics of gene expression changes

  • Integrative Computational Approaches:

    • Machine learning algorithms to predict phenotypes from genotypes

    • Apply Personalized Page Rank (PPR) algorithms to identify pleiotropic gene modules

    • Network-based approaches to position YGR114C within cellular pathways

  • Structural Biology Innovations:

    • Cryo-electron microscopy for membrane protein structures

    • Hydrogen-deuterium exchange mass spectrometry for protein dynamics

    • AlphaFold2 and other AI-based structure prediction tools

These technologies provide complementary approaches to unravel YGR114C's biological role and could lead to significant advancements in our understanding of this uncharacterized protein.

How might comprehensive phenotypic analysis of YGR114C contribute to our understanding of yeast biology?

Comprehensive phenotypic characterization of YGR114C can contribute to broader understanding of yeast biology in several ways:

  • Mapping the Phenotypic Landscape:

    • Systematic analysis across multiple conditions can reveal conditional functions

    • Integration into the global phenotypic correlation map can identify:

      • Unexpected correlations between unrelated traits

      • Trade-offs between growth rate and yield

      • Conditional fitness effects

  • Genetic Architecture Insights:

    • Identification of pleiotropic effects across multiple traits

    • Potential discovery of epistatic interactions

    • Understanding of regulatory rewiring mechanisms:

      • Different strains may exhibit similar phenotypes through different genetic mechanisms

      • Regulatory architecture may change through evolution

  • Stress Response Mechanisms:

    • YGR114C may play roles in specific stress responses

    • Oxidative stress tolerance studies could reveal:

      • Additive effect loci that can be closely linked

      • Contributions to cellular processes under stress conditions

  • Evolutionary Biology Applications:

    • Analysis of YGR114C conservation across yeast strains and species

    • Identification of selection pressures on specific protein domains

    • Understanding how uncharacterized proteins contribute to phenotypic diversity

This comprehensive approach positions YGR114C research within the broader context of systems biology, potentially revealing fundamental principles of cellular organization and adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.