Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR115C (YGR115C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with additional charges; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life is 6 months at -20°C/-80°C for liquid formulations and 12 months at -20°C/-80°C for lyophilized formulations.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
YGR115C; G6166; Putative uncharacterized protein YGR115C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGR115C
Target Protein Sequence
MSYISSILSDDRPVICVGCLMDCSLKSFFSWILLCLVSSSSSENSSSSMKSSNSSKIPPL SAVLFLFSWSSSSRPYSLFLPLRKPDSSSSSSSEKKSSNLDVESCLDAATLSLSDSAAFP SSPTLFNLLNFPEEELALVRSTPAFSINKSKSSSDSRSSSSLSLLLCFLLFLEILVPGSS FSSSSLTMKPSCTFLASSSSSSISSSSSEESKTSSPSSSSLGALVSSLSFTISSSSLGTS FESPVSSIKGKFYVKILGN
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YGR115C and why is it significant for research?

YGR115C is a putative uncharacterized protein in Saccharomyces cerevisiae, a model organism extensively used in molecular and cell biology research. This protein is significant because it represents one of many proteins in yeast that have homologs in higher eukaryotes, including humans. S. cerevisiae has been instrumental in understanding fundamental cellular processes, with many proteins important in human biology first discovered by studying their homologs in yeast . YGR115C, being uncharacterized, presents opportunities for novel discoveries in basic cellular functions.

How does YGR115C fit within the broader context of S. cerevisiae research?

S. cerevisiae is one of the most intensively studied eukaryotic model organisms, particularly valuable for understanding gene function and interactions. The availability of the complete genome sequence and deletion mutants covering approximately 90% of the yeast genome enhances the power of S. cerevisiae as a model for understanding eukaryotic cell regulation . YGR115C represents one of the genes that can be studied within the context of this comprehensive genetic interaction network, potentially revealing its role in cellular processes through its genetic interaction profile.

What experimental approaches are recommended for initial characterization of YGR115C?

For initial characterization, researchers should consider a multi-faceted approach:

  • Gene deletion studies to observe phenotypic effects

  • GFP tagging for protein localization

  • Transcriptional profiling under various conditions

  • Protein-protein interaction studies using yeast two-hybrid or co-immunoprecipitation

  • Comparative genomics to identify potential homologs in other species

These approaches provide a foundation for understanding the basic properties and potential functions of YGR115C, setting the stage for more detailed investigations.

How can I generate a YGR115C knockout strain in S. cerevisiae?

To generate a YGR115C knockout strain, researchers typically use homologous recombination techniques, exploiting the natural recombination machinery of S. cerevisiae . The process involves:

  • Design PCR primers with ~40bp homology to regions flanking the YGR115C gene

  • Amplify a selectable marker cassette (e.g., KanMX for G418 resistance)

  • Transform the PCR product into wild-type yeast cells

  • Select transformants on appropriate media

  • Confirm gene deletion by PCR and/or Southern blot analysis

This approach leverages S. cerevisiae's efficient homologous recombination system, which allows for precise gene targeting and manipulation.

What resources are available for studying genetic interactions of YGR115C?

Several resources are available for studying genetic interactions:

  • The Saccharomyces Genome Database (SGD) - provides comprehensive genetic information

  • Synthetic Genetic Array (SGA) analysis - allows systematic creation of double mutants

  • Global genetic interaction networks - can predict function based on interaction profiles

  • Deletion mutant collections - covers ~90% of all yeast genes for comparative studies

As of 2010, a comprehensive model of genetic interactions in S. cerevisiae contained interaction profiles for approximately 75% of all genes, based on 5.4 million two-gene comparisons through double gene knockouts . This model can be used to predict the function of uncharacterized genes like YGR115C based on their interaction patterns with genes of known function.

How can I design experiments to determine if YGR115C is involved in DNA repair or recombination pathways?

Designing experiments to investigate YGR115C's potential role in DNA repair or recombination requires a systematic approach:

  • Sensitivity assays: Test YGR115C deletion strains for sensitivity to DNA-damaging agents (X-rays, MMS, UV radiation, 8-methoxypsoralen)

  • Meiotic recombination analysis: Measure recombination frequencies in wild-type vs. YGR115C mutants

  • Double mutant analysis: Create double mutants with known DNA repair genes (e.g., RAD52) to identify potential epistatic relationships

  • Protein localization studies: Monitor YGR115C-GFP localization before and after DNA damage

  • Chromatin immunoprecipitation: Determine if YGR115C associates with chromatin during DNA damage response

Evidence from S. cerevisiae studies indicates that mutations in genes essential for recombination cause increased sensitivity to radiation or DNA-damaging chemicals . If YGR115C displays similar phenotypes, this would suggest involvement in DNA repair pathways.

What statistical models are appropriate for analyzing complex phenotypes in YGR115C mutants?

When analyzing complex phenotypes resulting from YGR115C mutations, appropriate statistical models depend on your experimental design:

  • For factorial designs with multiple factors affecting phenotype:
    Use a linear model that accommodates interaction effects:
    Yijkm=μ+αi+βj+γk+(αβ)ij+(αγ)ik+(βγ)jk+(αβγ)ijk+εijkmY_{ijkm} = \mu + \alpha_i + \beta_j + \gamma_k + (\alpha\beta)_{ij} + (\alpha\gamma)_{ik} + (\beta\gamma)_{jk} + (\alpha\beta\gamma)_{ijk} + \varepsilon_{ijkm}

  • For within-subject designs where the same yeast strain is measured under multiple conditions:
    Consider block design approaches where subjects (strains) serve as blocks

  • For gene interaction studies:
    Compare observed vs. expected fitness effects using models that quantify genetic interactions as deviations from the expected combined effect of individual mutations

Selection of an appropriate model should consider factors such as independence of observations, variance structure, and the specific hypotheses being tested.

How can I integrate YGR115C functional data with broader systems biology approaches?

Integrating YGR115C functional data with systems biology approaches requires:

  • Network analysis: Position YGR115C within protein-protein interaction and genetic interaction networks

  • Multi-omics integration: Combine transcriptomic, proteomic, and metabolomic data to create a comprehensive view of YGR115C's impact

  • Pathway enrichment analysis: Identify biological pathways enriched among genes/proteins that interact with YGR115C

  • Comparative genomics: Align with functional data from homologs in other species

  • Global genetic interaction mapping: Use similarity of genetic interaction profiles to predict function, as genes with similar profiles tend to be part of the same pathway or biological process

This integration can reveal unexpected connections and place YGR115C within the broader cellular context, potentially identifying its role in specific biological processes.

What are the optimal conditions for expressing recombinant YGR115C in S. cerevisiae?

For optimal expression of recombinant YGR115C:

ParameterRecommended ConditionRationale
PromoterGAL1 or ADH1Strong, regulated expression
VectorCentromeric (low-copy)Reduces burden on cellular machinery
TagC-terminal 3xHA or GFPLess likely to interfere with function
StrainBY4741 or W303Well-characterized backgrounds
MediaSynthetic complete lacking selection markerMaintains plasmid selection
Induction2% galactose (for GAL1)Optimal for GAL1 promoter activity
Temperature30°CStandard growth for S. cerevisiae
Growth phaseMid-log phase (OD600 ~0.6-0.8)Optimal cellular metabolism

Consider testing expression levels and protein solubility under various conditions to optimize for your specific experimental needs.

How can I design experiments to identify genetic interactions of YGR115C using systematic approaches?

To systematically identify genetic interactions of YGR115C:

  • Synthetic Genetic Array (SGA) analysis:

    • Create a YGR115C deletion strain with a selectable marker

    • Cross with an array of ~5,000 viable yeast deletion mutants

    • Select double mutants through sequential selection steps

    • Quantify colony size as a measure of fitness

    • Identify synthetic lethal or synthetic sick interactions

  • Quantitative analysis of genetic interactions:

    • Calculate expected fitness based on single mutant phenotypes

    • Identify deviations from expectations as genetic interactions

    • Classify interactions as negative (worse than expected) or positive (better than expected)

  • Interaction profile analysis:

    • Generate a comprehensive interaction profile for YGR115C

    • Compare with profiles of characterized genes

    • Cluster genes with similar profiles to predict function

This approach has successfully identified functions for previously uncharacterized genes by showing that genes with similar genetic interaction profiles tend to function in the same pathway or biological process.

What approaches can be used to study YGR115C's potential role in cell division or cytokinesis?

To investigate YGR115C's potential role in cell division or cytokinesis:

  • Cell cycle synchronization experiments:

    • Monitor YGR115C expression and localization throughout the cell cycle

    • Determine if protein levels are cell cycle-regulated

  • Cytological analysis:

    • Examine bud morphology and septin ring formation in YGR115C mutants

    • Look for defects in actomyosin ring (AMR) assembly or constriction

    • Analyze primary septum (PS) formation

  • Time-lapse microscopy:

    • Track cytokinesis timing and dynamics in live cells

    • Compare wild-type and YGR115C mutant strains

  • Genetic interaction studies:

    • Test for interactions with known cytokinesis genes (e.g., septin genes, AMR components)

    • Look for synthetic phenotypes that might reveal redundant functions

Given that S. cerevisiae divides asymmetrically by budding and utilizes specific structures like the actomyosin ring and primary septum during cytokinesis , examining YGR115C's relationship to these processes could reveal functional roles.

How should I interpret conflicting results regarding YGR115C function?

When faced with conflicting results:

  • Evaluate experimental conditions: Different growth conditions, strain backgrounds, or experimental approaches may reveal different aspects of YGR115C function

  • Consider multifunctional nature: Many proteins perform multiple roles depending on cellular context; YGR115C may have context-dependent functions

  • Examine genetic background effects: S. cerevisiae strain differences can significantly impact phenotypic outcomes

  • Assess technical limitations: Different methodologies have different sensitivities and biases

  • Design reconciliation experiments: Specifically target the contradiction with experiments designed to resolve the discrepancy

  • Use orthogonal approaches: Employ fundamentally different techniques to investigate the same question

Remember that apparently conflicting results may actually reveal different facets of a complex biological reality, particularly for uncharacterized proteins where the full spectrum of functions remains unknown.

What bioinformatic approaches can predict potential functions of YGR115C?

Bioinformatic approaches for functional prediction include:

  • Sequence homology analysis:

    • BLAST against characterized proteins

    • Multiple sequence alignment to identify conserved domains

    • Phylogenetic analysis to trace evolutionary relationships

  • Structural prediction:

    • Ab initio or homology-based 3D structure prediction

    • Identification of structural motifs associated with specific functions

  • Genome context methods:

    • Gene neighborhood analysis

    • Gene fusion events

    • Phylogenetic profiling

  • Network-based approaches:

    • Analyze placement within protein interaction networks

    • Use "guilt by association" principle where functionally related proteins often interact

  • Gene expression correlation:

    • Identify genes with similar expression patterns across conditions

    • Exploit the principle that co-expressed genes often function in related processes

These computational approaches can provide initial hypotheses about YGR115C function that can guide experimental design and interpretation.

How can I determine if YGR115C is involved in meiosis or recombination repair pathways?

To investigate YGR115C's potential role in meiosis or recombination repair:

Experimental ApproachMethodologyExpected Outcome if Involved
DNA damage sensitivityExpose YGR115C mutants to various DNA-damaging agents (X-rays, MMS, 8-methoxypsoralen-plus-UVA)Increased sensitivity compared to wild-type
Meiotic recombination rateMeasure genetic recombination frequencies in wild-type vs. YGR115C mutantsAltered recombination rates if involved in meiotic recombination
Double mutant analysisCreate double mutants with known recombination genes (e.g., RAD52)Epistatic or synergistic effects on recombination phenotypes
Return-to-growth assaysInduce meiosis then return cells to vegetative growthDecreased viability if YGR115C is involved in meiotic processes
Sporulation efficiencyMeasure spore formation in homozygous YGR115C deletion diploidsReduced sporulation or spore viability if involved in meiosis
ImmunofluorescenceVisualize localization during meiotic progressionCo-localization with recombination machinery during meiosis

Evidence from S. cerevisiae suggests that genes involved in recombination repair show increased sensitivity to radiation or DNA damaging chemicals and reduced meiotic recombination , providing benchmarks against which YGR115C phenotypes can be compared.

What are the most promising future research directions for understanding YGR115C function?

Based on current knowledge of S. cerevisiae biology, promising research directions include:

  • Integration with global genetic interaction networks to position YGR115C within cellular functional maps

  • Investigation of potential roles in fundamental processes like DNA repair, meiosis, or cell division based on phenotypic similarities to known genes in these pathways

  • Comparative genomics across fungal species to determine conservation and potential specialized functions

  • Proteomic approaches to identify physical interaction partners under various cellular conditions

  • CRISPR-based approaches for precise genomic editing to study specific domains or residues

  • Exploration of condition-specific functions by testing growth and cellular responses across diverse environmental stresses

The comprehensive genetic interaction networks available for S. cerevisiae provide a powerful framework for contextualizing novel findings about YGR115C and generating testable hypotheses about its function .

How can I best contribute to the collective understanding of uncharacterized proteins like YGR115C?

To maximize your contribution to understanding uncharacterized proteins:

  • Adopt an open science approach: Share data, protocols, and resources to accelerate collective discovery

  • Develop standardized phenotyping procedures: Enable direct comparison across studies and laboratories

  • Integrate diverse methodologies: Combine genetic, biochemical, and computational approaches

  • Focus on fundamental mechanisms: Connect YGR115C to conserved cellular processes

  • Contribute to community resources: Submit findings to databases like SGD to build collective knowledge

  • Collaborate across disciplines: Partner with specialists in complementary techniques

  • Address reproducibility: Carefully validate findings across different conditions and genetic backgrounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.