Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR160W (YGR160W)

Shipped with Ice Packs
In Stock

Description

Definition and Gene Context

YGR160W is a 203-amino-acid protein (1–203 aa) with a theoretical molecular weight of ~22.2 kDa . The gene is located on chromosome VII and is annotated as "uncharacterized" due to limited functional data . Key characteristics include:

  • Sequence Motifs: Repeated hydrophobic regions (e.g., "MTPPMCSNSFFNHSSSIDHDSLPTKIVAGSSVSSFFCFLLEDSSSSSSSASSDLRFLSLD") suggest potential transmembrane domains .

  • Overlapping Genes: YGR160W overlaps with NSR1 (nucleolar silencing regulator), a gene critical for ribosome biogenesis. Deletion studies often attribute phenotypes to NSR1 rather than YGR160W .

Recombinant Protein Production

The recombinant protein is synthesized in heterologous systems for research purposes. Key production parameters:

ParameterDetails
Host SystemsE. coli, yeast, or mammalian cells
TagN-terminal His-tag for purification
Purity≥85% (SDS-PAGE validated)
StorageLyophilized or in Tris-based buffer with 50% glycerol (-20°C/-80°C)

Partial-length variants are also available for specialized applications .

Functional Hypotheses

While direct evidence is limited, YGR160W has been implicated in:

  • Ribosomal Stress Response: Deletion of YGR160W (or NSR1) in hypoxia-tolerant yeast strains reduces ribosomal protein abundance and alters stress-responsive pathways .

  • Protein Interaction Networks: Hypothetical interactions with ribosomal or nucleolar proteins are inferred from its genomic context .

Experimental Applications

Recombinant YGR160W is used in:

  • Immunoassays: Rabbit polyclonal antibodies (e.g., IgG isotype) target YGR160W for ELISA or Western blotting .

  • Protein-Protein Studies: Cell-free expression systems enable interaction mapping with other yeast proteins .

Hypoxia Tolerance Studies

A genome-wide screen identified YGR160W deletion (or NSR1 disruption) as enhancing hypoxia tolerance in S. cerevisiae . Key observations:

StrainRibosomal ProteinsMetal Ion-Binding ProteinsOxidation-Reduction Proteins
Wild-type (BY4741)483014
Δygr160w171013

Note: Downregulated proteins dominate in Δygr160w strains .

Genomic Context and Synthetic Biology

In synthetic chromosome construction (e.g., Sc2.0), YGR160W’s overlap with NSR1 complicates functional analysis. Synthetic variants of NSR1 in megachunk S caused fitness defects, potentially linked to YGR160W’s loxPsym site insertion .

Challenges and Unresolved Questions

  • Functional Ambiguity: Overlap with NSR1 makes attributing phenotypes to YGR160W challenging .

  • Expression Patterns: No validated expression data exist for YGR160W under standard conditions .

  • Pathway Involvement: No curated GO annotations or pathway memberships are documented .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, specific format requests should be noted during order placement to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YGR160W; G7004; Putative uncharacterized protein YGR160W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGR160W
Target Protein Sequence
MTPPMCSNSFFNHSSSIDHDSLPTKIVAGSSVSSFFCFLLEDSSSSSSSASSDLRFLSLD SSFSLSLSEDEDEDESELEDSFDSSFLVSSFSSSSSSSEEESEEEEEESLDSSFLVSASL SLSEDDEEEDSESEDEDEDEDSDSDSDSDSDSDEDEDEDEDSEEEEETALAFSSLACLEA LTSFLLPFTLVVLAILFYPAWVE
Uniprot No.

Target Background

Database Links

STRING: 4932.YGR160W

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YGR160W and why is it classified as a "dubious ORF"?

YGR160W is a putative uncharacterized protein in Saccharomyces cerevisiae (baker's yeast) that is classified as a "dubious ORF" because it overlaps with the NSR1 gene on the complementary strand. Genomic analyses suggest it is unlikely to be an expressed protein . The classification as "dubious" indicates that while the sequence contains features of an ORF, experimental evidence does not support its expression as a functional protein, and any phenotypic effects observed when deleting this region likely result from impacts on the overlapping NSR1 gene rather than from YGR160W itself .

How does YGR160W relate to the NSR1 gene structurally?

YGR160W overlaps with the NSR1 gene but is positioned on the opposite strand. In the context of the Sc2.0 synthetic yeast genome project, this overlapping arrangement resulted in the insertion of an additional loxPsym site immediately downstream of the YGR160W stop codon, which affected the 5' UTR of NSR1 . This structural overlap creates challenges for genetic manipulation, as modifications to one sequence inherently affect the other.

What experimental evidence suggests YGR160W is not expressed?

Studies comparing deletion strains of YGR160W (Δygr160w) and NSR1 (Δnsr1) demonstrated that their phenotypes are essentially identical, supporting the hypothesis that YGR160W itself does not encode a functional protein . Additionally, proteomic analyses have failed to detect peptides uniquely attributable to YGR160W, despite extensive proteomic mapping of the yeast proteome. These findings collectively suggest that any phenotypic effects observed in Δygr160w strains derive from the deletion's impact on NSR1 rather than from the loss of YGR160W .

How can researchers effectively study overlapping genes like YGR160W and NSR1?

When studying overlapping genes like YGR160W and NSR1, researchers should:

  • Use strand-specific RNA sequencing to differentiate transcription from complementary strands

  • Employ ribosome profiling to determine if translation occurs from both strands

  • Design mutations that affect only one gene without disrupting the other (when possible)

  • Implement CRISPR-Cas9 with precise guide RNAs for targeted modifications

  • Conduct comparative phenotypic analyses between single and double mutants

For YGR160W specifically, researchers found success by mating the affected strain (synVIIS) with single gene knockout strains corresponding to the megachunk S region, which helped identify that the synthetic NSR1 gene was responsible for the observed fitness defect .

What protocols are recommended for expression analysis of YGR160W?

For comprehensive expression analysis of YGR160W and surrounding genomic regions, the following protocol has proven effective:

RNA Extraction and Transcriptome Analysis:

  • Culture yeast cells to mid-log phase (A600 of 0.6-0.8)

  • Add cycloheximide (0.1 mg/ml final concentration) to freeze translation

  • Extract RNA using established protocols (e.g., Ambion RiboPure Yeast kit)

  • Perform strand-specific RNA-seq to distinguish transcription from opposite strands

  • Map reads to reference genome using TopHat

  • Analyze differential expression using DEseq2

Protein Detection:

  • Extract proteins using iTRAQ reagent-8plex multiplex kit

  • Fractionate peptides with high pH RP method

  • Analyze using mass spectrometry (e.g., Q Exactive HF-X)

  • Process data with Mascot and IQuant for protein identification and quantification

When analyzing such data, note that for dubious ORFs like YGR160W, absence of protein detection provides additional evidence for its non-functional status.

How is YGR160W relevant in synthetic biology projects like Sc2.0?

In the Sc2.0 project, which aims to create a synthetic yeast genome, YGR160W presented unique design challenges due to its overlap with NSR1. The project implemented specific design features:

  • Two synthetic PCRTags were introduced within the NSR1 coding region

  • A loxPsym site was placed at the 3' UTR of NSR1

  • An additional loxPsym site was inserted downstream of the YGR160W stop codon

This implementation resulted in unexpected consequences: transcriptome profiling revealed approximately 6-fold upregulation of NSR1 transcription in the synVIIS strain compared to synVIIT, while paradoxically, the Nsr1 protein abundance was drastically reduced . This case study demonstrates how synthetic modifications of overlapping genome features can produce complex phenotypic outcomes and emphasizes the importance of considering overlapping genetic elements in synthetic biology design.

What bioinformatic approaches can identify and analyze dubious ORFs like YGR160W?

Advanced bioinformatic approaches for analyzing dubious ORFs include:

Computational Analysis Pipeline:

  • Implement sequence conservation analysis across related yeast species

  • Calculate codon adaptation index (CAI) to assess likelihood of expression

  • Perform ribosome profiling data analysis to detect translation events

  • Use machine learning algorithms trained on known expressed vs. non-expressed ORFs

  • Analyze RNA-seq data with specific attention to strand-specificity and expression patterns

For YGR160W specifically, researchers have used advanced clustering methods to analyze its expression patterns across different experimental conditions. Below is an example of clustering results incorporating YGR160W from one study:

GroupConsistent genes included in the group
1ybl045c, ykl026c, ylr258w
2yhl015w, yil053w, ylr029c
3ygr043c, ygl191w, ynl117w
4none of all
5ymr290c, ylr180w

Table 1: Clustering results by curve clustering when the number of cluster size is five .

This type of analysis helps researchers understand the expression patterns and potential functional relationships between dubious ORFs and well-characterized genes.

How can researchers distinguish phenotypic effects caused by YGR160W deletion versus effects on NSR1?

To distinguish phenotypic effects of YGR160W deletion from effects on NSR1, researchers should:

  • Generate precise deletions using CRISPR-Cas9 to target specific regions of either YGR160W or NSR1

  • Create a complementation series with different versions of the NSR1 gene (with and without modifications to the overlapping YGR160W region)

  • Perform quantitative phenotypic assays under various stress conditions

  • Compare transcriptome and proteome profiles between wild-type, ΔnSR1, and Δygr160w strains

  • Conduct epistasis analysis with genes known to interact with NSR1

Research has shown that deletion strains of YGR160W (Δygr160w) exhibit essentially identical phenotypes to NSR1 deletion strains (Δnsr1), strongly supporting that observed effects derive from NSR1 disruption rather than YGR160W loss .

What stress response pathways are affected by manipulations involving the YGR160W locus?

Stress response studies examining the genomic region containing YGR160W and NSR1 have identified several key affected pathways:

Experimental Design for Stress Response Analysis:

  • Culture yeast strains (wild-type, synthetic strains, deletion mutants) to mid-log phase

  • Subject cells to various stressors (temperature extremes, pH variations, chemical agents)

  • Measure growth rates and viability using spot dilution assays

  • Perform transcriptome analysis focusing on Environmental Stress Response (ESR) genes

  • Compare protein abundance between strains using quantitative proteomics

A typical stress sensitivity assay protocol involves:

  • Culturing single colonies overnight in YPD medium at 30°C

  • Performing 10-fold serial dilutions and spotting onto selective plates

  • Incubating plates with drugs or adjusted pH (4.0 and 9.0) at 30°C for 2-4 days

  • Incubating additional plates at 25°C and 37°C for temperature stress evaluation

Research on synthetic strains with modifications in this region revealed that disomic strains exhibited the Environmental Stress Response (ESR) transcriptional signature, with >70% of reported iESR genes up-regulated and >80% of rESR genes down-regulated .

How should researchers interpret contradictory data regarding YGR160W expression?

When encountering contradictory data regarding YGR160W expression, consider these methodological approaches:

  • Cross-validate with multiple techniques:

    • Compare RNA-seq, microarray, and qRT-PCR data

    • Verify protein expression using Western blots, mass spectrometry, and GFP-tagging

    • Analyze ribosome footprinting data to confirm translation

  • Consider technical limitations:

    • Assess the strand-specificity of sequencing methods

    • Evaluate the sensitivity and specificity of antibodies or detection methods

    • Account for cross-hybridization issues in microarray studies

  • Examine experimental conditions:

    • Different growth conditions may affect expression patterns

    • Stress conditions might activate cryptic transcription sites

    • Cell cycle stage can influence expression profiles

One notable contradiction observed in research was in synthetic yeast strains, where NSR1 showed 6-fold upregulation at the transcript level while the protein abundance was drastically reduced . This paradox highlights the importance of integrated multi-omics analyses for accurate interpretation.

What statistical approaches are most appropriate for analyzing dubious ORFs in genome-wide studies?

For robust statistical analysis of dubious ORFs like YGR160W in genome-wide studies:

Statistical Methodology Recommendations:

  • Implement stringent multiple testing corrections (e.g., Benjamini-Hochberg FDR)

  • Use specialized models that account for overlapping genomic features

  • Apply baseline correction techniques to account for cross-hybridization

  • Employ curve clustering methods to identify consistent expression patterns

  • Calculate coefficient of variation (CV) across experiments to filter genes with inconsistent expression

One effective approach used in a microarray study filtered genes using coefficient of variation (CV) calculated as the ratio of standard deviation over the average of regression slopes across experiments. Genes with CV values larger than a threshold (e.g., 2.1) were filtered out . This type of statistical filtering is particularly important for dubious ORFs, which often show inconsistent patterns across experiments.

How might CRISPR-Cas9 technology advance research on dubious ORFs like YGR160W?

CRISPR-Cas9 technology offers unprecedented opportunities for precise manipulation of dubious ORFs like YGR160W:

  • Targeted Modifications Without Disrupting Overlapping Genes:

    • Design guide RNAs targeting specific regions of YGR160W without affecting NSR1

    • Introduce silent mutations to study sequence-specific effects

    • Create precise deletions of subregions to map functional domains

  • Base Editing Applications:

    • Use cytosine or adenine base editors to introduce point mutations without double-strand breaks

    • Modify start or stop codons to test translational effects

    • Alter potential regulatory motifs to examine expression control

  • Epigenetic Modifications:

    • Apply CRISPR-dCas9 systems to modulate chromatin structure at the YGR160W locus

    • Study the effects of targeted histone modifications on expression of both YGR160W and NSR1

    • Investigate the role of antisense transcription in regulation

These approaches would allow researchers to definitively determine whether YGR160W has any functional significance independent of its overlap with NSR1, potentially resolving its dubious ORF status.

What insights might systems biology approaches provide about the evolutionary significance of dubious ORFs like YGR160W?

Systems biology approaches can elucidate the evolutionary significance of dubious ORFs through:

  • Comparative Genomics Analysis:

    • Examine conservation patterns across Saccharomyces species and other fungi

    • Assess selection pressures on overlapping coding regions

    • Investigate the emergence and disappearance of ORFs across evolutionary time

  • Network Integration:

    • Incorporate dubious ORFs into protein-protein interaction networks

    • Analyze co-expression patterns across diverse conditions

    • Identify potential functional associations through guilt-by-association approaches

  • Evolutionary Simulations:

    • Model the birth and death of overlapping ORFs in silico

    • Simulate the effects of various selection pressures on genome compactness

    • Test hypotheses about the adaptive value of genomic complexity

For YGR160W specifically, an integrative systems approach could explore whether its overlap with NSR1 serves any regulatory function, or if it represents an evolutionary relic or a proto-gene in the process of either becoming functional or being lost.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.