Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR228W (YGR228W)

Shipped with Ice Packs
In Stock

Description

Genetic and Functional Characterization

The YGR228W locus in S. cerevisiae is annotated as a dubious ORF by the Saccharomyces Genome Database (SGD), with no experimental evidence supporting its functionality . Key genomic features include:

PropertyDetails
Gene Length114 amino acids
Sequence FeaturesNo conserved domains or motifs identified
Functional AnnotationsNo GO terms, phenotypes, or interaction data available
Evolutionary ConservationNo orthologs detected in other species

The lack of expression data and functional studies suggests YGR228W may not encode a biologically active protein under standard conditions .

Recombinant Protein Production

Commercial suppliers produce recombinant YGR228W using heterologous expression systems. Specifications vary by vendor:

ParameterCreative BioMart MyBioSource
Host SystemE. coliE. coli, Yeast, Baculovirus, Mammalian Cells
TagN-terminal His tagNot specified
Purity>90% (SDS-PAGE)≥85% (SDS-PAGE)
Sequence (1-114 aa)MLIVIFHKAIFSNSSLASSTLASSLLISFSSFLFISSVCLFTSSSFFADSVTCSFSTCSFSSTFGCFSSSFLSLSCLMSTLSALISCSACPRLSVFTVVVSASLGSVFTILTDS Partial sequences available
ApplicationsStructural studies, antibody productionELISA, Western Blot

Controversies and Limitations

  • Functional Uncertainty: The SGD designation as a non-functional ORF conflicts with its commercial availability, raising questions about its utility in research .

  • Sequence Redundancy: The amino acid sequence lacks homology to characterized proteins, and biochemical activity remains unverified .

Future Directions

Proposed studies include:

  1. Knockout Experiments: Validate whether YGR228W deletion impacts yeast viability or phenotype .

  2. Interaction Screens: Identify potential binding partners using affinity purification .

  3. Post-Translational Modifications: Investigate phosphorylation or glycosylation sites .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YGR228W; Putative uncharacterized protein YGR228W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGR228W
Target Protein Sequence
MLIVIFHKAIFSNSSLASSTLASSLLISFSSFLFISSVCLFTSSSFFADSVTCSFSTCSF SSTFGCFSSSFLSLSCLMSTLSALISCSACPRLSVFTVVVSASLGSVFTILTDS
Uniprot No.

Target Background

Database Links

STRING: 4932.YGR228W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YGR228W and what are its basic properties?

YGR228W is a putative uncharacterized protein in Saccharomyces cerevisiae consisting of 114 amino acids. According to available data, it is encoded by a gene located on chromosome VII of the S. cerevisiae genome. The protein has been recombinantly expressed with an N-terminal His-tag in E. coli expression systems to facilitate purification and subsequent research. As an uncharacterized protein, its specific biological function remains to be fully elucidated through experimental research. The protein sequence analysis suggests potential hydrophobic regions which might indicate membrane association, though this requires experimental validation. Understanding YGR228W function could provide insights into fundamental cellular processes in yeast and potentially reveal connections to conserved mechanisms in higher eukaryotes .

How is recombinant YGR228W protein expressed and purified for research studies?

Recombinant YGR228W protein is typically expressed in E. coli expression systems as indicated by the product information. The full-length protein (amino acids 1-114) is fused to an N-terminal His-tag to facilitate purification. The established protocol involves:

  • Cloning the YGR228W coding sequence into a suitable expression vector

  • Transforming the construct into an E. coli expression strain

  • Inducing protein expression under optimized conditions

  • Harvesting cells and lysing them to release the recombinant protein

  • Purifying the His-tagged protein using immobilized metal affinity chromatography (IMAC)

  • Performing quality control through SDS-PAGE to ensure purity greater than 90%

  • Lyophilizing the purified protein for long-term storage

The purified recombinant protein can be reconstituted in appropriate buffers for downstream applications such as functional assays, antibody production, or structural studies. Storage conditions are critical - the lyophilized powder should be stored at -20°C/-80°C, with working aliquots maintained at 4°C for up to one week to avoid degradation from repeated freeze-thaw cycles .

How should I design experiments to systematically characterize the function of YGR228W?

Systematic characterization of an uncharacterized protein like YGR228W requires a multi-faceted experimental approach to generate complementary lines of evidence. The experimental design should include:

  • Genetic manipulation studies:

    • Generate clean deletion strains (ygr228wΔ) in different genetic backgrounds

    • Create conditional expression systems (e.g., tetracycline-regulatable promoters)

    • Develop tagged versions for localization and interaction studies

    • Compare phenotypes across different conditions (temperature, nutrients, stressors)

  • Localization and expression analysis:

    • Determine subcellular localization using fluorescent protein fusions

    • Examine expression patterns under different conditions and growth phases

    • Investigate protein levels and turnover rates

  • Interaction partner identification:

    • Perform affinity purification coupled with mass spectrometry

    • Conduct yeast two-hybrid screens

    • Validate interactions through co-immunoprecipitation

    • Use proximity labeling approaches (BioID, APEX)

  • Phenotypic characterization:

    • Assess growth rates in various media and conditions

    • Examine response to different stressors

    • Analyze changes in chronological and replicative lifespan

    • Investigate metabolic profiles

This systematic approach allows researchers to triangulate the function through multiple independent lines of evidence, similar to approaches used for characterizing other uncharacterized yeast genes like YBR238C, which was found to regulate chronological lifespan through a mitochondrial-dependent pathway .

What controls should be included when studying YGR228W through gene deletion or overexpression?

Control TypeDescriptionPurpose
Wild-type strainIsogenic parent strainBaseline comparison for all phenotypic analyses
Empty vectorPlasmid backbone without YGR228WControl for vector effects in complementation/overexpression
Complementationygr228wΔ with reintroduced YGR228WVerify phenotypes are due to YGR228W absence
Tagged controlygr228wΔ with tagged YGR228WAssess tag interference with function
Related gene deletionDeletion of genes in similar pathwaysContextual comparison of phenotypes
Expression level controlsTitration of expression levelsEvaluate dose-dependent effects

How can I optimize the storage and handling of recombinant YGR228W protein for functional studies?

Proper storage and handling of recombinant YGR228W is critical for maintaining protein integrity and activity. Based on the product information and general protein handling practices, optimal conditions include:

  • Storage recommendations:

    • Store lyophilized powder at -20°C/-80°C for long-term stability

    • Keep working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles which can cause protein degradation and aggregation

  • Reconstitution and buffer considerations:

    • Reconstitute in appropriate buffer based on downstream applications

    • Consider adding stabilizers such as glycerol (10-15%) for frozen storage

    • Maintain pH within the protein's stable range (typically near physiological pH)

    • Include protease inhibitors for protein solutions to prevent degradation

  • Quality control measures:

    • Verify protein integrity by SDS-PAGE before use in experiments

    • Consider dynamic light scattering to assess aggregation state

    • If applicable, verify activity using functional assays

For handling recombinant YGR228W specifically, product documentation indicates greater than 90% purity as determined by SDS-PAGE, suggesting the protein is suitable for most research applications when properly stored and handled .

How can I use comparative genomics to gain insights into YGR228W function?

Comparative genomics provides valuable insights into uncharacterized proteins by leveraging evolutionary relationships. For YGR228W, this approach would involve:

  • Ortholog identification across species:

    • Identify YGR228W orthologs in other fungi using sensitive sequence comparison tools (BLAST, HMMer)

    • Extend search to more distant eukaryotes to identify potential functional homologs

    • Examine presence/absence patterns across different lineages

  • Sequence conservation analysis:

    • Generate multiple sequence alignments of identified orthologs

    • Identify highly conserved residues likely critical for function

    • Detect regions under purifying selection (low dN/dS ratio)

    • Map conservation patterns onto structural models

  • Genomic context analysis:

    • Examine synteny (gene order conservation) across species

    • Identify consistently co-occurring genes that might function in the same pathway

    • Look for fusion events with other domains in different organisms

  • Paralog analysis:

    • Identify paralogs within S. cerevisiae genome

    • Compare expression patterns and phenotypic effects between paralogs

    • Investigate potential subfunctionalization or neofunctionalization

This comparative approach has proven valuable for characterizing other yeast proteins like YBR238C, which was identified as an effector of TORC1 signaling through comparative analysis with other genes affecting lifespan .

What transcriptomic and proteomic approaches would be most informative for understanding YGR228W function?

Multi-omics approaches provide comprehensive insights into protein function by examining system-wide effects of genetic perturbations. For YGR228W, the following approaches would be particularly informative:

  • Transcriptomic analyses:

    • RNA-Seq comparing wild-type and ygr228wΔ strains under multiple conditions

    • Time-course analysis following YGR228W induction/repression

    • Single-cell RNA-Seq to capture cell-to-cell variation

    • Ribosome profiling to assess translational impacts

  • Proteomic approaches:

    • Global proteome analysis using LC-MS/MS

    • Phosphoproteomics to identify altered signaling pathways

    • Protein turnover analysis using pulse-chase methods

    • Protein-protein interaction mapping through AP-MS or BioID

  • Integrated analysis strategies:

    • Correlation network analysis across multiple data types

    • Pathway enrichment analysis to identify affected cellular processes

    • Causal network modeling to distinguish direct from indirect effects

    • Comparison with existing datasets from related genes

Similar approaches have been successfully applied to other uncharacterized yeast genes. For example, transcriptomic analysis of YBR238C deletion mutants revealed 326 upregulated and 61 downregulated genes, highlighting its role in mitochondrial function and aging pathways .

How can I investigate potential roles of YGR228W in disease models and translational research?

While YGR228W is a yeast protein, investigating its function may have translational relevance through conserved cellular pathways. Approaches to explore potential disease relevance include:

  • Identifying human homologs or functional analogs:

    • Use sensitive sequence search methods to find distant human homologs

    • Identify proteins with similar structural features or domains

    • Look for complementation of yeast phenotypes by human genes

  • Modeling disease-relevant pathways in yeast:

    • Express human disease-associated proteins in yeast with YGR228W modifications

    • Study interactions between YGR228W and conserved disease-relevant pathways

    • Use yeast as a platform for high-throughput drug screening

  • Investigating roles in fundamental cellular processes:

    • Examine potential roles in conserved processes like protein quality control

    • Study effects on stress response pathways relevant to disease states

    • Investigate impacts on cellular aging and longevity mechanisms

Saccharomyces cerevisiae has been extensively used as a model for human disease research, particularly for studying processes related to aging, neurodegeneration, and RNA-mediated pathways. Its well-studied genome and conserved proteome across eukaryotes make it an ideal system for investigating fundamental biological processes with potential relevance to human health .

How should I approach data analysis when studying an uncharacterized protein like YGR228W?

Analyzing data for uncharacterized proteins requires careful consideration of multiple factors to avoid misinterpretation. A robust analytical framework includes:

  • Statistical rigor:

    • Ensure appropriate statistical tests based on data distribution

    • Calculate effect sizes in addition to p-values

    • Implement multiple testing correction for high-throughput data

    • Conduct power analysis to determine adequate sample sizes

  • Data integration strategies:

    • Triangulate findings using multiple experimental approaches

    • Employ Bayesian methods to integrate prior knowledge with new data

    • Use dimension reduction techniques for high-dimensional data

    • Apply network analysis to place findings in biological context

  • Validation approaches:

    • Confirm key findings using orthogonal methods

    • Test predictions with targeted follow-up experiments

    • Compare results across different strain backgrounds

    • Validate in related species when possible

  • Interpretation frameworks:

    • Consider both direct and indirect effects

    • Distinguish correlation from causation through intervention studies

    • Develop testable models that explain observed phenotypes

    • Contextualize findings within known biological pathways

For example, when analyzing transcriptomic data, enrichment analysis can identify overrepresented biological processes among differentially expressed genes. This approach was used to characterize YBR238C function, revealing its role in mitochondrial processes through identification of transcription factors like HAP4 that were enriched among upregulated genes .

How can I reconcile contradictory results about YGR228W function from different experimental approaches?

Contradictory results are common when studying uncharacterized proteins and require systematic analysis to reconcile:

  • Methodological comparisons:

    • Examine differences in experimental conditions (media, temperature, growth phase)

    • Compare strain backgrounds and genetic markers

    • Assess differences in protein expression levels or tagging strategies

    • Evaluate assay sensitivity and specificity

  • Conditional function analysis:

    • Test if apparent contradictions are due to context-dependent functions

    • Examine temporal aspects of protein function

    • Investigate environmental contingencies

    • Consider genetic background effects

  • Integration approaches:

    • Develop models that accommodate apparently contradictory observations

    • Weight evidence based on methodological rigor

    • Use probabilistic frameworks to assess confidence in different results

    • Identify common elements among seemingly disparate findings

  • Resolution experiments:

    • Design studies specifically to address contradictions

    • Test competing hypotheses with decisive experiments

    • Reproduce critical findings under identical conditions

    • Collaborate with labs reporting different results

This approach is particularly relevant for YGR228W-like proteins where limited information exists. Similar challenges have been encountered with other yeast genes like YBR238C, where careful validation across different strain backgrounds (BY4743 and CEN.PK) and multiple experimental methods was necessary to confirm its role in chronological lifespan regulation .

What bioinformatic tools and databases are most useful for predicting YGR228W function?

A comprehensive bioinformatic analysis of YGR228W should leverage multiple computational tools and databases:

  • Sequence analysis tools:

    • BLAST, PSI-BLAST for homology detection

    • HHpred for remote homology through hidden Markov models

    • MOTIF Search and PROSITE for functional motif identification

    • SignalP, TMHMM for predicting cellular targeting and topology

  • Structure prediction resources:

    • AlphaFold for 3D structure prediction

    • PyMOL for structural visualization and analysis

    • ProFunc for structure-based function annotation

    • FunFOLD for ligand binding site prediction

  • Functional annotation databases:

    • Saccharomyces Genome Database (SGD) for curated yeast information

    • UniProt for protein annotation

    • STRING for protein-protein interaction networks

    • Gene Ontology for functional classification

  • Specialized yeast resources:

    • SPELL for co-expression analysis

    • YeastMine for integrating multiple data types

    • YeastNet for functional gene networks

    • PomBase for comparison with S. pombe

  • Integrated analysis platforms:

    • InterPro for integrated domain and family analysis

    • KEGG for pathway mapping

    • Cytoscape for network visualization and analysis

    • Galaxy for workflow creation and execution

Bioinformatic analysis of other uncharacterized yeast proteins has provided valuable insights. For example, sequence architecture analysis of YBR238C revealed an intrinsically unstructured region and a pentatricopeptide repeat region with potential RNA binding function based on sequence homology to its paralog RMD9 .

What emerging technologies could accelerate functional characterization of YGR228W?

Cutting-edge technologies offer new opportunities for characterizing uncharacterized proteins like YGR228W:

  • CRISPR-based technologies:

    • CRISPRi/CRISPRa for tunable gene expression modulation

    • Base editing for precise modification of specific nucleotides

    • Prime editing for targeted insertions and replacements

    • CRISPR screening platforms for high-throughput phenotyping

  • Advanced imaging approaches:

    • Super-resolution microscopy for precise localization

    • Live-cell imaging with optimized fluorescent proteins

    • Correlative light and electron microscopy

    • Fluorescence lifetime imaging for protein-protein interactions

  • Single-cell technologies:

    • Single-cell RNA-Seq for heterogeneity analysis

    • Single-cell proteomics for protein-level insights

    • Microfluidic platforms for controlled cellular environments

    • High-content image-based screening at single-cell resolution

  • Structural biology innovations:

    • Cryo-EM for visualizing protein complexes

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Integrative structural biology combining multiple data types

    • In-cell NMR for studying proteins in native environment

These emerging technologies could be applied to accelerate the characterization of YGR228W, similar to how advanced approaches have helped characterize other yeast proteins involved in fundamental cellular processes .

How might YGR228W research contribute to understanding broader biological principles?

Research on uncharacterized proteins like YGR228W can yield insights into fundamental biological principles:

  • Evolutionary perspectives:

    • Understanding protein family evolution and diversification

    • Elucidating the emergence of new protein functions

    • Identifying core conserved processes across species

    • Revealing lineage-specific adaptations

  • Systems biology insights:

    • Mapping previously unknown nodes in cellular networks

    • Understanding robustness and redundancy in biological systems

    • Discovering new regulatory mechanisms

    • Identifying emergent properties of complex systems

  • Methodological advances:

    • Developing systematic approaches for protein characterization

    • Creating transferable workflows for studying uncharacterized proteins

    • Establishing benchmarks for computational prediction accuracy

    • Advancing integrative analysis approaches

  • Translational implications:

    • Uncovering potential new drug targets

    • Identifying previously unknown disease mechanisms

    • Developing yeast as a platform for studying human gene variants

    • Creating tools for synthetic biology applications

This aligns with how research on other yeast genes has contributed to our understanding of fundamental processes like aging, RNA-mediated pathways, and mitochondrial function, with implications beyond yeast biology to human health and disease .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.