Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR242W (YGR242W)

What is YGR242W and what are its basic characteristics?

YGR242W is a putative uncharacterized protein from the yeast Saccharomyces cerevisiae with a length of 102 amino acids. The protein has the following amino acid sequence: MVQAVSDNLISNAWVISCNPLALEVPERIGSTYFCFGGAIFILVAPLTNLVYNEDIVSQTRLYIYYRGSRDSRACMLDIVTLVDVSKRSKLVLLLQIYFFSF . Despite being annotated in the yeast genome, its specific biological function remains largely uncharacterized, making it a subject of interest for fundamental research in protein function discovery. Current annotations classify it as a putative protein, indicating that computational predictions suggest its existence, but experimental validation of its function is still limited.

How is recombinant YGR242W protein typically produced for research purposes?

Recombinant YGR242W is typically produced through heterologous expression in E. coli systems. The methodological approach involves:

• Cloning the YGR242W gene (encoding amino acids 1-102) into an appropriate expression vector

• Adding an N-terminal histidine tag to facilitate purification

• Transforming the construct into E. coli expression strains

• Inducing protein expression under optimized conditions

• Purifying the protein using affinity chromatography

• Lyophilizing the purified protein for storage and stability

The resulting recombinant protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with a recommendation to add 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C .

What expression data is available for YGR242W in current databases?

According to the Saccharomyces Genome Database, there is currently no expression data available for YGR242W . This absence of expression data presents both a challenge and an opportunity for researchers. The lack of readily available expression profiles suggests that:

• The gene may be expressed under very specific conditions not captured in existing datasets

• Expression levels may be below detection thresholds in standard assays

• Regulation of this gene might occur under specialized cellular conditions

Researchers interested in expression patterns can utilize tools like SPELL (Serial Pattern of Expression Levels Locator) to identify genes with potentially similar expression profiles that might provide contextual information about YGR242W function .

What are the optimal conditions for functional characterization of YGR242W protein?

Methodological approach for functional characterization of YGR242W should consider:

• Protein stability assessment: Given the unknown nature of YGR242W, stability assays should be conducted across various buffer conditions (pH range 5.0-8.0) and temperature ranges (4-37°C)

• Experimental conditions from related proteins: Drawing from studies of other uncharacterized yeast proteins, the following conditions have proven effective:

  Parameter	Recommended Range	Rationale
  pH	5.0-6.0	Optimal for yeast cellular environment as demonstrated in chemostat studies
  Temperature	25-30°C	Matches physiological conditions for S. cerevisiae
  Salt concentration	50-150 mM NaCl	Maintains protein solubility while mimicking cellular ionic strength
  Reducing agents	1-5 mM DTT or 0.5-2 mM TCEP	Prevents oxidation of cysteine residues

• Activity assays: Since the function is unknown, a systematic approach testing for enzymatic activities (hydrolase, transferase, kinase) should be employed

• Protein-protein interaction studies: Yeast two-hybrid or pull-down assays using the recombinant His-tagged protein to identify potential interaction partners

When interpreting results, researchers should be prepared to adjust their hypotheses as new data emerges, particularly when dealing with uncharacterized proteins where initial predictions may be contradicted by experimental evidence .

How should researchers approach transcriptome analysis to understand YGR242W expression under different conditions?

For transcriptome analysis of YGR242W, researchers should consider:

• Chemostat culture approach: Establish controlled growth conditions in chemostats with defined synthetic media limiting growth by various factors (carbon, nitrogen, phosphorus, or sulfur) to analyze expression under different metabolic states

• Experimental parameters for chemostat setup:

  • Working volume: 1.0 liter

  • Dilution rate: 0.10 h⁻¹

  • pH: 5.0 (maintained using automatic addition of 2 M KOH)

  • Stirrer speed: 800 rpm

  • For anaerobic conditions: Sparging with pure nitrogen gas (0.5 liter min⁻¹)

  • Culture stabilization: Sample after 10-14 volume changes to avoid strain adaptation due to long-term cultivation

• Microarray analysis protocol:

  • Platform recommendation: Affymetrix Genechip® microarrays or RNA-seq

  • Data processing: Log2 transformation and normalization of expression data

  • Replication: Minimum of three independently cultured replicates for statistical validity

  • Data filtering: Apply appropriate significance thresholds (e.g., setting values below 12 to 12 to eliminate insignificant variations)

• Promoter analysis: If differential expression is observed, analyze the promoter region of YGR242W for regulatory motifs such as those found in oxygen-responsive genes (e.g., TCGTwyAG, CCTCGTwy, ATTGTTC, AAGGCAC)

This systematic approach will provide insights into the conditions under which YGR242W is expressed, potentially revealing clues about its functional role.

What strategies should be employed when YGR242W experimental data contradicts initial functional predictions?

When experimental data contradicts initial hypotheses about YGR242W function, researchers should:

• Thoroughly examine the data: Identify specific discrepancies between expected and observed results, paying particular attention to outliers that may influence interpretation

• Reevaluate experimental design: Consider potential confounding factors in the experimental setup that might affect protein behavior:

  • Expression system limitations (E. coli vs. native yeast expression)

  • Tag interference with protein function (His-tag position effect)

  • Buffer composition effects on protein activity

  • Presence of inhibitors or activators in the experimental system

• Alternative hypothesis development: Generate new working hypotheses that accommodate the contradictory data:

  • Consider post-translational modifications not present in recombinant systems

  • Evaluate potential protein-protein interactions required for function

  • Assess subcellular localization effects on function

• Comparative analysis with related proteins: Even though YGR242W is uncharacterized, structural or sequence similarities with characterized proteins might provide insights. For example, the methodological approach used for characterizing YGR262c (a Ser/Thr protein kinase) revealed unique features such as:

  • Specific metal ion requirements (Mn²⁺ or Co²⁺ instead of typical Mg²⁺)

  • Substrate specificity (phosphorylation of casein and osteopontin but not histones or other common substrates)

• Data validation: Implement additional controls and replicate experiments using alternative methods to confirm unexpected findings

This systematic approach transforms contradictory data from a research obstacle into an opportunity for novel discoveries about YGR242W function.

What purification techniques are most effective for obtaining high-purity YGR242W protein for structural studies?

For structural studies requiring high-purity YGR242W, the following methodological approach is recommended:

• Initial expression optimization:

  • Test multiple E. coli expression strains (BL21(DE3), Rosetta, Arctic Express)

  • Optimize induction conditions (IPTG concentration, temperature, duration)

  • Consider codon optimization for the S. cerevisiae sequence

• Multi-step purification protocol:

  • Immobilized metal affinity chromatography (IMAC) using the His-tag

  • Size exclusion chromatography to remove aggregates and impurities

  • Ion exchange chromatography as a polishing step if necessary

• Quality control metrics:

  Quality Parameter	Target Value	Assessment Method
  Purity	>95%	SDS-PAGE and densitometry
  Monodispersity	>90%	Dynamic light scattering (DLS)
  Folding	Properly folded	Circular dichroism (CD) spectroscopy
  Activity	Function-dependent	Specific activity assays

• Protein stability optimization:

  • Screen buffer conditions systematically (pH, salt, additives)

  • Evaluate thermal stability using differential scanning fluorimetry

  • Test protein stabilizing agents (glycerol, arginine, trehalose)

• Reconstitution protocol:

  • Reconstitute lyophilized protein in deionized sterile water

  • Adjust to 0.1-1.0 mg/mL concentration

  • Add 5-50% glycerol for long-term storage

  • Aliquot to avoid freeze-thaw cycles

This comprehensive approach ensures obtaining protein of sufficient quality for demanding structural biology techniques such as X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy.

How can researchers design experiments to identify potential interaction partners of YGR242W?

To identify potential interaction partners of the uncharacterized YGR242W protein, researchers should implement multiple complementary approaches:

• Affinity purification coupled with mass spectrometry (AP-MS):

  • Express His-tagged YGR242W in S. cerevisiae under native or inducible promoters

  • Perform gentle cell lysis to preserve protein complexes

  • Capture complexes using anti-His antibodies or Ni-NTA resin

  • Identify co-purifying proteins by mass spectrometry

  • Filter results against appropriate negative controls to eliminate false positives

• Yeast two-hybrid (Y2H) screening:

  • Create bait constructs with YGR242W fused to a DNA-binding domain

  • Screen against a comprehensive S. cerevisiae genomic prey library

  • Validate positive interactions with secondary assays such as co-immunoprecipitation

  • Quantify interaction strength using reporter gene expression

• Proximity-dependent biotin identification (BioID):

  • Generate YGR242W fusion with a promiscuous biotin ligase (BirA*)

  • Express in yeast cells and allow biotinylation of proximal proteins

  • Purify biotinylated proteins and identify by mass spectrometry

  • Map the proximal interactome of YGR242W in its native cellular context

• Genetic interaction mapping:

  • Perform synthetic genetic array (SGA) analysis with YGR242W deletion strain

  • Identify genes that show synthetic lethality or growth defects when combined with YGR242W deletion

  • Analyze genetic interaction networks to predict functional relationships

• Data integration and visualization:

  Interaction Type	Method	Strengths	Limitations
  Physical	AP-MS	Captures native complexes	May miss transient interactions
  Binary	Y2H	Detects direct interactions	Prone to false positives
  Proximity	BioID	Maps spatial relationships	Not all proximal proteins interact
  Genetic	SGA	Reveals functional relationships	Indirect evidence of interaction

• Computational prediction validation:

  • Use the amino acid sequence of YGR242W (MVQAVSDNLISNAWVISCNPLALEVPERIGSTYFCFGGAIFILVAPLTNLVYNEDIVSQTRLYIYYRGSRDSRACMLDIVTLVDVSKRSKLVLLLQIYFFSF) to predict domains and interaction motifs

  • Validate predicted interactions experimentally

This multi-faceted approach maximizes the chances of identifying biologically relevant interaction partners for this uncharacterized protein.

What are the best approaches for analyzing the subcellular localization of YGR242W?

Determining the subcellular localization of YGR242W is crucial for understanding its function. The following methodological approaches are recommended:

• Fluorescent protein tagging:

  • Generate C-terminal and N-terminal GFP fusion constructs of YGR242W

  • Express from native promoter in S. cerevisiae

  • Compare localizations of both constructs to ensure tag position doesn't disrupt targeting signals

  • Perform live-cell imaging under various growth conditions and stresses

  • Co-localize with established organelle markers (nucleus, ER, Golgi, mitochondria, vacuole)

• Immunofluorescence microscopy:

  • Generate specific antibodies against YGR242W or use anti-His antibodies with tagged constructs

  • Fix and permeabilize yeast cells using established protocols

  • Perform co-staining with organelle markers

  • Analyze using confocal microscopy for high-resolution localization

• Biochemical fractionation:

  • Perform sequential centrifugation to separate cellular compartments

  • Analyze fractions by Western blotting to detect YGR242W

  • Compare distribution with known marker proteins for each subcellular compartment

  Fraction	Centrifugation Conditions	Marker Proteins
  Nuclei	1,000 × g, 10 min	Histone H3
  Mitochondria	10,000 × g, 15 min	Porin
  Microsomes (ER/Golgi)	100,000 × g, 1 h	Sec61p, Emp47p
  Cytosol	Supernatant after 100,000 × g	Pgk1p

• Prediction-guided analysis:

  • Analyze the amino acid sequence for targeting signals:

    • The sequence MVQAVSDNLISNAWVISCNPLALEVPERIGSTYFCFGGAIFILVAPLTNLVYNEDIVSQTRLYIYYRGSRDSRACMLDIVTLVDVSKRSKLVLLLQIYFFSF contains hydrophobic regions that may indicate membrane association

  • Test predictions experimentally using truncation constructs to identify essential localization sequences

• Inducible mislocalization:

  • Add ectopic targeting signals to redirect YGR242W to specific compartments

  • Assess functional consequences of mislocalization

  • Use this approach to test compartment-specific functionality hypotheses

Integrating these approaches provides robust evidence for the native subcellular localization of YGR242W, offering valuable insights into its potential cellular functions.

How should researchers analyze transcriptomic data to identify conditions affecting YGR242W expression?

For effective analysis of transcriptomic data related to YGR242W, researchers should follow this methodological framework:

• Data preprocessing and normalization:

  • Perform log2 transformation of raw expression values

  • Apply appropriate normalization methods to account for technical variation

  • Filter low-quality or unreliable measurements (e.g., values below detection threshold)

• Differential expression analysis:

  • Compare YGR242W expression across multiple conditions (e.g., different nutrient limitations, aerobic vs. anaerobic, stress conditions)

  • Apply statistical tests with appropriate multiple testing correction

  • Establish significance thresholds (fold change ≥2, adjusted p-value <0.05)

• Co-expression network analysis:

  • Identify genes with expression patterns similar to YGR242W

  • Construct correlation networks to visualize relationships

  • Apply clustering algorithms to identify functional modules

  • Use tools like SPELL (Serial Pattern of Expression Levels Locator) to find genes with similar expression profiles

• Condition-specific expression patterns:

  • Analyze expression in specialized conditions such as:

    • Nutrient limitation (carbon, nitrogen, phosphorus, sulfur)

    • Oxygen availability (aerobic vs. anaerobic)

    • Growth phase (log, stationary)

    • Stress responses (heat, osmotic, oxidative)

• Integration with regulatory information:

  • Scan YGR242W promoter region for known transcription factor binding sites

  • Identify potential regulatory motifs similar to those found in other yeast genes:

  Regulatory Motif	Associated Factor	Biological Context
  TCGTwyAG or CCTCGTwy	Similar to Upc2p binding site	Anaerobic response
  ATTGTTC	Rox1p binding site	Anaerobic regulation
  AAGGCAC	Novel motif (unknown factor)	Potentially oxygen-responsive

• Visualization and interpretation:

  • Create heatmaps showing YGR242W expression across conditions

  • Apply principal component analysis to identify major sources of variation

  • Generate expression profiles comparing YGR242W with functionally characterized genes

This systematic approach allows researchers to identify specific conditions that affect YGR242W expression, providing insights into its regulation and potential function.

What analytical methods should be used when experimental data about YGR242W contradicts computational predictions?

When faced with contradictions between computational predictions and experimental data for YGR242W, researchers should employ the following analytical framework:

• Systematic evaluation of discrepancies:

  • Clearly identify the specific predictions that are contradicted by experimental evidence

  • Categorize discrepancies (functional, structural, localization, expression)

  • Quantify the degree of contradiction using appropriate metrics

• Critical assessment of prediction methods:

  • Evaluate the reliability of algorithms used for prediction

  • Consider limitations of sequence-based predictions for novel proteins

  • Assess whether the sequence of YGR242W (MVQAVSDNLISNAWVISCNPLALEVPERIGSTYFCFGGAIFILVAPLTNLVYNEDIVSQTRLYIYYRGSRDSRACMLDIVTLVDVSKRSKLVLLLQIYFFSF) contains unusual features that might confound standard prediction tools

• Experimental validation strategies:

  • Design targeted experiments to specifically address the contradictions

  • Employ orthogonal methods to verify unexpected findings

  • Use controlled conditions to isolate variables potentially causing discrepancies

• Integration of diverse data types:

  Data Type	Analysis Method	Application to YGR242W
  Sequence analysis	Multiple sequence alignment, motif detection	Identify conserved regions in YGR242W
  Structural data	Homology modeling, ab initio prediction	Generate structural models despite contradictions
  Expression data	Conditional expression analysis	Map conditions where YGR242W is expressed
  Interaction data	Network analysis	Place YGR242W in functional context

• Iterative refinement of models:

  • Update computational models with experimental constraints

  • Develop hybrid models that incorporate both predicted and experimental data

  • Apply machine learning approaches to improve predictions based on experimental outcomes

• Alternative hypothesis formulation:

  • Generate new testable hypotheses that accommodate both the computational predictions and experimental observations

  • Consider novel or context-dependent functions not captured by standard prediction methods

This methodical approach transforms contradictions into opportunities for deeper understanding, potentially leading to novel insights about YGR242W function that wouldn't emerge from either computational or experimental approaches alone.

What are the most promising future research directions for understanding YGR242W function?

Based on current knowledge and gaps in understanding, the following research directions show particular promise for elucidating YGR242W function:

• Comprehensive phenotypic analysis:

  • Generate YGR242W deletion and overexpression strains

  • Perform high-throughput phenotypic screening under diverse conditions

  • Apply chemical genomics approaches to identify conditions where YGR242W becomes essential

• Structural biology approaches:

  • Determine the three-dimensional structure using X-ray crystallography, NMR, or cryo-EM

  • Identify structural homologs that might suggest function

  • Map conserved residues onto the structure to identify potential functional sites

• Systems biology integration:

  • Position YGR242W within the broader cellular network through multi-omics approaches

  • Apply network inference algorithms to predict functional relationships

  • Use genome-scale metabolic models to predict metabolic roles

• Evolutionary analysis:

  • Perform deep phylogenetic analysis across fungi and related organisms

  • Identify patterns of co-evolution with functionally characterized genes

  • Analyze selection pressures on YGR242W to infer functional constraints

• Advanced genetic approaches:

  • Apply CRISPR-based screens to identify genetic interactions

  • Develop conditional alleles to study essential functions

  • Use domain-swapping experiments to test functional hypotheses

By pursuing these complementary research directions, investigators can systematically address the fundamental question of YGR242W function, potentially revealing novel biological insights about this uncharacterized protein in Saccharomyces cerevisiae.

How should researchers integrate multiple experimental approaches to build a comprehensive understanding of YGR242W?

To develop a comprehensive understanding of YGR242W, researchers should implement an integrated experimental strategy:

• Multi-level data integration framework:

  • Combine data from genomic, transcriptomic, proteomic, and metabolomic analyses

  • Develop computational pipelines to integrate heterogeneous data types

  • Apply network modeling to position YGR242W in cellular pathways

• Collaborative research model:

  • Establish interdisciplinary collaborations spanning computational biology, structural biology, genetics, and biochemistry

  • Implement standardized protocols to ensure data comparability

  • Share reagents, strains, and data through community resources

• Iterative hypothesis refinement:

  Phase	Approach	Outcome
  Initial characterization	Broad phenotypic screening	Generate hypotheses about function
  Focused investigation	Targeted biochemical assays	Test specific functional predictions
  Mechanistic studies	Detailed molecular analyses	Establish precise biochemical role
  Systems integration	Network analysis	Position function in cellular context

• Handling contradictory results:

  • Systematically address discrepancies between different experimental approaches

  • Consider context-dependent functions that may manifest differently under varied conditions

  • Use contradictions as opportunities to discover novel biological principles

• Technology development:

  • Adapt emerging methodologies for challenging uncharacterized proteins

  • Develop specialized assays for proposed YGR242W functions

  • Apply innovative approaches like deep mutational scanning to map sequence-function relationships

This integrated strategy maximizes the potential for discovering the true function of YGR242W by leveraging complementary approaches and systematically addressing the challenges inherent in characterizing uncharacterized proteins.