The Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YGR265W (YGR265W) is a synthetic version of an uncharacterized protein derived from Saccharomyces cerevisiae (baker’s yeast). It is produced via recombinant DNA technology in Escherichia coli and includes an N-terminal histidine (His) tag for purification and stability .
| Property | Detail |
|---|---|
| UniProt ID | P53325 |
| Gene Name | YGR265W |
| Protein Length | Full-length (136 amino acids) |
| Host Organism | E. coli |
| Expression Region | 1–136 aa (full-length) |
The amino acid sequence (AA sequence) is:
MTYLRIALASNKRKGSFVLRNSMAALSLSTSGFKFLLAYSSARAIFKLFANCKWAGCFFD LSKEMRKDMLVVNFRFFFKFYSSTKMHIRKQIIINIRHRRKFVIVFFFFSFSLSISCVQK FFLPPKSFVPRDIEKK .
The protein is expressed in E. coli and purified using chromatography, leveraging the His tag for affinity binding . Post-purification, it is lyophilized and stored at -20°C or -80°C with 50% glycerol to prevent degradation .
| Supplier | Catalog Number | Key Features |
|---|---|---|
| Creative BioMart | RFL36713SF | His-tagged, full-length, >90% purity |
| Gene Biosystems | CSB-CF347405SVG | Tris-based buffer, 50% glycerol |
YGR265W is a gene locus in Saccharomyces cerevisiae that encodes a protein whose biological function has not been experimentally validated. The term "putative" indicates it has been computationally predicted to encode a protein, while "uncharacterized" signifies that its biological role, biochemical properties, and structural features remain largely unknown. According to the Saccharomyces Genome Database, there is no expression data available for YGR265W, further reflecting its uncharacterized status .
The pYES vector collection is specifically designed for high-level expression of recombinant proteins in S. cerevisiae, making it ideal for expressing proteins like YGR265W. These vectors offer:
Regulated expression via the GAL1 promoter for controlled induction
Multiple vector options with varying origins of replication for different expression levels
Several cloning technologies including TOPO® Cloning and Gateway™ Technology
The key vector types include:
pYES2.1/V5-His TOPO® (5.9 kb) - Features 2μ origin for high-copy maintenance and URA3 selection
pYES-DEST52 (7.8 kb) - Combines Gateway™ technology with GAL1 regulation
pYES2/CT and pYES3/CT - Offer URA3 and TRP1 selection markers respectively
pYES6/CT - Contains Blasticidin resistance for selection in any strain regardless of auxotrophic markers
For proteins that may be toxic when highly expressed, pYC vectors containing the CEN6/ARSH4 origin provide lower copy numbers within yeast cells .
To verify successful expression of YGR265W, utilize the epitope tags engineered into the pYES vectors:
Detection methods:
Western blotting: Using antibodies against the vector-provided tags:
Affinity purification: His-tagged proteins can be purified using nickel columns, allowing for:
Quantification of expression levels
Assessment of protein solubility
Further characterization studies
Cellular localization: Fluorescence microscopy using antibodies against epitope tags or GFP fusion constructs to determine subcellular distribution
Mass spectrometry: For confirmatory identification and potential post-translational modification analysis
The GAL1 promoter in pYES vectors provides tight regulation of expression through carbon source manipulation:
Induction protocol:
Grow transformed yeast in glucose-containing medium to desired density (glucose represses the GAL1 promoter)
Harvest cells by centrifugation and wash thoroughly to remove residual glucose
Resuspend in media containing galactose as carbon source to induce expression
Incubate at appropriate temperature (typically 30°C for standard growth, but 20-25°C may improve folding)
Monitor expression at multiple time points (4, 8, 12, 24 hours) to determine optimal induction time
Key considerations:
Transcription from the GAL1 promoter is repressed by glucose and induced by galactose
Lower temperatures during induction often improve folding and solubility
Expression levels may vary depending on the specific protein and strain background
For efficient yeast transformation with YGR265W expression constructs:
Recommended method:
The S.c. EasyComp™ Transformation Kit offers advantages over traditional methods:
Preparation of competent cells takes less than 30 minutes
Uses ready-to-use, quality-tested solutions
More efficient than spheroplast formation and traditional LiCl methods
Protocol overview:
Grow yeast culture to log phase (OD600 = 0.6-0.8)
Prepare competent cells using kit solutions
Mix competent cells with plasmid DNA and transformation solution
Heat shock at 42°C for 1 hour
Plate on selective media appropriate for the vector's selection marker:
Uncovering the function of YGR265W requires a multi-faceted approach:
Computational strategies:
Sequence analysis:
Homology searches across species
Protein domain and motif identification
Structural prediction using tools like AlphaFold
Network analysis:
Co-expression patterns with characterized genes
Integration with protein-protein interaction data
Metabolic pathway association analysis
Experimental strategies:
Gene disruption approaches:
CRISPR-Cas9 knockout
Conditional degradation systems
Dominant negative mutations
Phenotypic assays:
Growth under various conditions (temperature, carbon sources, stress)
Cellular morphology analysis
Metabolite profiling
Protein-level studies:
Localization determination
Interaction partner identification
Post-translational modification analysis
Being systematic in this approach is critical, as seen in studies of other uncharacterized yeast proteins like those in the ORF collections analyzed with neural network methods .
To investigate potential connections between YGR265W and the observed SynII phenotypic defect at 37°C on YPG media:
Experimental design:
Complementation analysis:
Expression analysis:
Compare YGR265W expression levels between wild-type and SynII strains
Perform qRT-PCR and western blotting at various temperatures
Analyze results for expression differences that correlate with phenotype
Targeted mutagenesis:
Generate specific mutations in YGR265W
Analyze which domains/residues are critical for function
Test mutants for ability to complement the 37°C YPG defect
Data collection and analysis:
| Strain | Growth at 30°C (YPD) | Growth at 37°C (YPD) | Growth at 30°C (YPG) | Growth at 37°C (YPG) | YGR265W Complementation |
|---|---|---|---|---|---|
| WT | ++++ | ++++ | ++++ | ++++ | N/A |
| SynII | ++++ | ++++ | ++++ | + | N/A |
| SynII + YGR265W | ++++ | ++++ | ++++ | ++++ | Yes |
| SynII + empty vector | ++++ | ++++ | ++++ | + | No |
This approach follows the methodology demonstrated in previous research where the SynII defect at 37°C on YPG media was successfully rescued by complementing with a wild-type gene .
When facing expression challenges with YGR265W:
For toxicity issues:
Vector selection:
Induction optimization:
Use lower galactose concentrations for partial induction
Reduce induction temperature to 20-25°C
Shorten induction time
For solubility issues:
Fusion tag strategies:
Add solubility-enhancing tags (MBP, GST, SUMO)
Include fusion proteases for tag removal
Position tags at either N- or C-terminus to determine optimal configuration
Expression conditions:
Screen multiple growth media formulations
Test various induction temperatures (16°C, 20°C, 25°C, 30°C)
Optimize induction duration through time-course analysis
Co-expression approaches:
Co-express molecular chaperones to aid folding
Include pathway partners that may stabilize YGR265W
Optimization matrix:
To predict functions of YGR265W using bioinformatic approaches:
Sequence-based analysis:
Homology detection:
Position-Specific Iterative BLAST (PSI-BLAST) against multiple databases
Hidden Markov Model (HMM) profiling for remote homology detection
Sensitive sequence comparison tools (HHpred, HMMER)
Evolutionary analysis:
Conservation patterns across fungal species
Synteny analysis of genomic context
Detection of co-evolving residues suggesting functional sites
Structure-based prediction:
Structural modeling:
Generate 3D models using AlphaFold2
Assess model confidence using prediction metrics
Identify structural similarities with characterized proteins
Functional site prediction:
Identify potential binding pockets and catalytic sites
Predict protein-protein interaction interfaces
Analyze electrostatic and hydrophobic surface properties
Integrated approaches:
Multi-feature machine learning:
Pathway and network analysis:
Analyze co-expression patterns
Examine genetic interaction profiles
Study metabolic network positioning
To systematically identify and validate protein interactions of YGR265W:
Unbiased screening methods:
Yeast two-hybrid (Y2H):
Clone YGR265W into bait vector
Screen against genome-wide prey library
Filter results based on reporter activation strength
Verify interactions through secondary assays
Affinity purification-mass spectrometry (AP-MS):
Proximity-based labeling:
Create fusion of YGR265W with BioID or APEX2
Express in yeast using inducible GAL1 promoter
Perform proximity labeling in vivo
Identify biotinylated proteins by streptavidin purification and MS
Validation approaches:
Co-immunoprecipitation:
Reciprocal tagging of candidate interactors
Western blot analysis of co-precipitated proteins
Competition assays to test interaction specificity
Bimolecular fluorescence complementation (BiFC):
Create split-fluorescent protein fusions
Visualize interactions in living cells
Quantify interaction strength through fluorescence intensity
Interaction network analysis:
| Analytical Dimension | Method | Outcome |
|---|---|---|
| Physical interactions | AP-MS, Y2H | Direct binding partners |
| Functional associations | Genetic interactions | Pathway connections |
| Spatial proximity | Proximity labeling | Neighborhood mapping |
| Temporal dynamics | Time-course AP-MS | Interaction kinetics |
| Structural details | Crosslinking-MS | Interface identification |
For genetic manipulation of YGR265W using CRISPR-Cas9:
Gene knockout strategy:
Guide RNA design:
Design sgRNAs targeting the 5' and 3' regions of YGR265W
Ensure specificity using genome-wide off-target prediction tools
Synthesize or clone sgRNAs into appropriate vectors
Repair template preparation:
Design homology arms (40-60 bp) flanking the YGR265W locus
Include selection marker (e.g., KanMX) between homology arms
Verify template integrity by sequencing
Delivery and screening:
Transform yeast with Cas9, sgRNA, and repair template
Select transformants on appropriate media
Verify deletion by PCR and sequencing
Perform phenotypic characterization under various conditions
Precise editing applications:
Domain analysis:
Introduce specific mutations in predicted functional domains
Create truncation variants to map essential regions
Engineer chimeric proteins to test domain function
Tagging strategies:
Add fluorescent proteins for localization studies
Insert epitope tags for immunoprecipitation
Create degron fusions for conditional depletion
Promoter engineering:
Replace native promoter with regulatable alternatives
Create reporter fusions to study expression patterns
Implement CRISPR interference for tunable repression
Phenotypic analysis framework:
| Analysis Category | Methods | Expected Outcomes |
|---|---|---|
| Growth phenotypes | Spotting assays, growth curves | Fitness under various conditions |
| Cellular morphology | Microscopy | Morphological abnormalities |
| Stress response | Chemical/environmental challenges | Sensitivity/resistance profiles |
| Metabolic changes | Metabolomics | Altered metabolite levels |
| Gene expression | RNA-seq | Transcriptional responses |
This approach allows for comprehensive functional characterization of YGR265W through precise genetic manipulation.
To biochemically characterize purified recombinant YGR265W:
Expression and purification strategy:
Vector selection:
Purification approach:
Lyse cells under optimized conditions (mechanical disruption, detergents)
Perform immobilized metal affinity chromatography using His-tag
Apply secondary purification (ion exchange, size exclusion)
Verify purity by SDS-PAGE and mass spectrometry
Biochemical characterization:
Structural studies:
Circular dichroism spectroscopy for secondary structure
Thermal shift assays for stability assessment
Limited proteolysis to identify stable domains
X-ray crystallography or cryo-EM for high-resolution structure
Functional assays:
Enzymatic activity screening against substrate libraries
Binding assays using label-free techniques (ITC, SPR, BLI)
Mass spectrometry to identify post-translational modifications
Oligomerization state determination by analytical ultracentrifugation
Data integration table:
| Characterization Level | Techniques | Information Gained |
|---|---|---|
| Primary sequence | Mass spectrometry | Exact mass, modifications |
| Secondary structure | Circular dichroism | α-helix/β-sheet content |
| Tertiary structure | X-ray crystallography, NMR | Atomic-level structure |
| Quaternary structure | SEC-MALS, AUC | Oligomerization state |
| Function | Activity assays, binding studies | Biochemical role |
| Dynamics | HDX-MS, NMR relaxation | Conformational flexibility |
To comprehensively investigate YGR265W function using multi-omics:
Experimental design:
Generate experimental system:
Multi-omics data collection:
Transcriptomics: RNA-seq under multiple conditions
Proteomics: Quantitative MS (SILAC, TMT)
Metabolomics: Targeted and untargeted approaches
Interactomics: AP-MS or proximity labeling
Phenomics: High-throughput phenotypic assays
Data integration and analysis:
Correlation analysis:
Identify genes/proteins with expression patterns correlated with YGR265W
Map transcriptional and translational responses to YGR265W perturbation
Correlate metabolite changes with pathway alterations
Network reconstruction:
Build gene regulatory networks
Construct protein-protein interaction networks
Map metabolic pathway alterations
Integrate networks across multiple data types
Functional prediction:
Apply machine learning for function prediction
Use clustering to identify functional groups
Perform enrichment analysis for biological processes
Integration framework:
| Data Type | Analysis Method | Integration Approach |
|---|---|---|
| Transcriptome | Differential expression | Co-expression modules |
| Proteome | Abundance changes | Protein complexes |
| Metabolome | Pathway mapping | Flux analysis |
| Phenome | Clustering | Phenotypic signatures |
| Interactome | Network analysis | Functional communities |
This multi-dimensional approach provides a comprehensive understanding of YGR265W function by capturing its impact across multiple levels of cellular organization.