Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YHL005C (YHL005C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
YHL005C; Uncharacterized protein YHL005C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YHL005C
Target Protein Sequence
MRKESFLTFYFSNHLYLCPAIIRLSSVCTLARTDYYLPSNIAVTYDIQISSLGFTYRIDF FLALFSDPARPFLTEINRKIGQYACVIREREQAGEYSFHYSLCININVYILHIHIYIDRY IYAYINAQVQ
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YHL005C and what are its basic structural properties?

YHL005C is a putative uncharacterized protein in Saccharomyces cerevisiae with a full length of 130 amino acids . The protein can be recombinantly expressed with a histidine tag to facilitate purification and analysis . While its specific cellular function remains unknown, it is one of many proteins in the yeast proteome that has not yet been fully characterized through functional genomics approaches.

The protein can be expressed recombinantly in E. coli systems with an N-terminal His-tag as confirmed by catalog information from protein resource databases . This suggests the protein does not contain post-translational modifications essential for its basic structure, as prokaryotic expression systems can produce the protein in a form suitable for basic characterization studies.

What expression systems are recommended for studying YHL005C?

While E. coli has been successfully used to express recombinant YHL005C with His-tag modifications , researchers should consider expression in its native host S. cerevisiae for functional studies. This is particularly important if the protein's function involves interactions with other yeast proteins or requires yeast-specific post-translational modifications.

For yeast expression, the K. lactis system offers several advantages for expressing S. cerevisiae proteins, including:

  • High yield protein expression capability

  • Ability to grow to high cell density

  • Methanol-free growth media requirements

  • Avoidance of toxicity problems sometimes encountered in E. coli expression

When expressing potentially toxic proteins, the K. lactis PLAC4-PBI promoter system offers significant advantages as it remains transcriptionally silent in E. coli while allowing strong expression in yeast systems .

How should deletion mutants be designed to study YHL005C function?

Creating yhl005c deletion mutants requires careful design considerations. Based on established protocols for similar yeast genes:

  • Single gene deletion: Replace the YHL005C coding sequence with a selectable marker (such as kanMX4 for G418 resistance) through homologous recombination .

  • For double mutant construction with other genes of interest:

    • Cross the yhl005cΔ::kanMX4 haploid strain with other gene deletion strains marked with different selectable markers (like HIS3MX6)

    • Select diploid cells through nutrient complementation on synthetic dropout media

    • Induce sporulation and analyze spore clones for the appropriate markers

    • Verify disruption through PCR analysis

When designing primers for gene deletion confirmation, ensure they anneal to genomic regions outside the recombination sites to verify proper integration of the deletion cassette.

What genetic screening approaches are most informative for identifying YHL005C function?

Several systematic approaches can be employed to characterize the function of uncharacterized proteins like YHL005C:

  • Synthetic Genetic Array (SGA) analysis: This approach involves creating double mutants with yhl005cΔ and thousands of other gene deletions to identify genetic interactions, similar to the approach used for other uncharacterized yeast genes .

  • Synthetic Dosage Lethal (SDL) screening: Overexpression of YHL005C in the background of deletion mutants can reveal additional genetic interactions, as demonstrated with other yeast genes like AFT1 .

  • Environmental stress response profiling: Exposing yhl005cΔ strains to various stressors (such as caffeine, calcofluor white, cisplatin, methyl methanesulfonate, or benomyl) can reveal sensitivity phenotypes that provide clues to function .

The following protocol has proven effective for stress response profiling:

  • Grow wild-type and mutant strains to mid-log phase in YPD at 25°C

  • Perform dot assays by spotting 5 μl of five-fold serial dilutions (OD600 = 0.1, 0.01, 0.001, 0.0001) onto media containing the stressor

  • Compare growth patterns between wild-type and mutant strains

How can epistasis analysis be used to place YHL005C in biological pathways?

Epistasis analysis with YHL005C involves systematically constructing double mutants with genes in known pathways to determine genetic relationships. The protocol includes:

  • Create double mutant strains of yhl005cΔ with genes from pathways of interest (e.g., DNA damage response genes like RAD52, as performed for other uncharacterized genes)

  • Compare phenotypic sensitivities between single and double mutants:

    • If the double mutant phenotype equals one of the single mutants, this suggests the genes function in the same pathway

    • If the double mutant shows greater sensitivity than either single mutant, this suggests the genes function in parallel or compensatory pathways

    • If the double mutant shows suppression of a single mutant phenotype, this suggests an antagonistic relationship

  • Validate findings through biochemical approaches such as co-immunoprecipitation or yeast two-hybrid analysis to confirm physical interactions between the protein products.

When performing epistasis analysis with YHL005C, it would be particularly relevant to examine relationships with stress response pathways given the tendency of uncharacterized yeast proteins to function in stress adaptation mechanisms.

What approaches can identify potential roles of YHL005C in DNA damage response?

Based on protocols used for similar uncharacterized yeast proteins, researchers should consider:

  • Phenotypic sensitivity screening: Test yhl005cΔ strains for sensitivity to DNA damaging agents like UV radiation, MMS, and γ-irradiation. For example, ypl055cΔ (another previously uncharacterized gene) was found to be UV sensitive and later identified as sensitive to γ-irradiation .

  • Recombination assays: Measure the ability of yhl005cΔ strains to undergo recombination following DNA damage, which could indicate whether YHL005C participates in recombination-mediated repair pathways.

  • Synthetic lethality with known repair genes: Examine interactions between yhl005cΔ and mutations in established DNA repair pathway genes (RAD52, RAD6, etc.), following protocols similar to those used for ESC4 and other genes involved in DNA damage response .

  • Localization studies: Determine whether YHL005C protein localizes to sites of DNA damage using fluorescently tagged constructs.

DNA Damaging AgentConcentration Range for TestingExposure TimeExpected Phenotype if YHL005C Involved
UV radiation5-100 J/m²Single exposureGrowth inhibition relative to WT
MMS0.005-0.05%ContinuousGrowth inhibition on plates
γ-irradiation100-300 GySingle exposureDecreased survival compared to WT
Hydroxyurea10-200 mMContinuousS-phase progression defects

What approaches are recommended for identifying YHL005C protein interactions?

To identify potential interacting partners of YHL005C, researchers should employ complementary approaches:

  • Affinity purification coupled with mass spectrometry: Using His-tagged YHL005C protein , researchers can perform pull-down experiments followed by mass spectrometry to identify co-purifying proteins.

  • Yeast two-hybrid screening: This approach can detect direct binary interactions between YHL005C and other proteins. The lack of background information on interactions makes this a particularly valuable approach.

  • Proximity-based labeling techniques: BioID or TurboID fusions to YHL005C can identify proteins in close proximity in vivo, potentially revealing functional contexts.

  • Co-fractionation studies: Analyzing which cellular fractions contain YHL005C can provide clues to its subcellular localization and potential interacting complexes.

For researchers conducting affinity purification experiments, optimized protocols should include:

  • Expression of His-tagged YHL005C in either E. coli or native S. cerevisiae

  • Gentle lysis conditions to preserve protein-protein interactions

  • Appropriate controls including non-specific binding to affinity resin

  • Stringent washing steps to remove non-specific interactions

  • Mass spectrometry analysis with appropriate statistical thresholds for identifying significant interactors

How can transcriptomic approaches be used to understand YHL005C function?

RNA-Seq analysis under various conditions can provide valuable insights into YHL005C function:

  • Comparative transcriptomics: Compare gene expression profiles between wild-type and yhl005cΔ strains under various conditions to identify genes whose expression is affected by YHL005C deletion.

  • Stress response profiling: Analyze transcriptional changes in response to stressors in wild-type versus yhl005cΔ strains, similar to approaches used for characterizing genes like AFT1 that coordinate stress responses .

  • Integration with existing datasets: Compare transcriptomic signatures of yhl005cΔ with publicly available datasets from characterized mutants to identify potential functional relationships.

The transcription factor Aft1 provides a useful model for this approach, as it was initially characterized through its role in iron regulon gene expression but was later implicated in diverse cellular processes including cell-cycle progression and chromosome stability through comprehensive genetic interaction studies .

What are the optimal protocols for random spore analysis with YHL005C mutants?

For genetic studies involving YHL005C, random spore analysis (RSA) offers a high-throughput approach to analyze recombinant haploid spores. Based on optimized protocols for diverse S. cerevisiae strains:

  • Heat shock treatment: Recent studies have shown that heat shock can effectively purge vegetative cells while enriching for spores in RSA protocols .

  • Strain-specific optimization: The optimal heat shock conditions vary by strain background:

    • European wine strain (DBVPG6765)

    • Japanese sake strain (Y12)

    • West African palm wine strain (DBVPG6044)

    • North American oak soil strain (YPS128)

  • Enhanced genetic diversity: Heat shock treatment during RSA leads to increased genetic diversity among surviving cells, which is particularly valuable for QTL mapping and experimental evolution research involving YHL005C .

When designing RSA experiments with YHL005C mutants, researchers should first determine the optimal heat shock conditions for their specific strain background by testing multiple combinations of temperature and incubation time, as different strains show varying responses to heat treatment .

How should researchers design experiments to study YHL005C in different yeast genetic backgrounds?

When studying YHL005C across different genetic backgrounds:

  • Deletion strategy consistency: Use the same deletion cassette and verification methods across all strain backgrounds to ensure comparable results.

  • Background-appropriate markers: Consider the auxotrophic markers available in each strain background:

    • Laboratory strains typically have well-defined auxotrophies

    • Wild or industrial strains may require dominant selectable markers like kanMX4

  • Phenotypic analysis standardization: When comparing phenotypes across backgrounds, standardize growth conditions and analysis methods:

    • For liquid growth assays, report both doubling time and maximum OD

    • For plate assays, use consistent cell concentrations and incubation times

    • Include appropriate reference strains for each background

  • Genetic interaction mapping: Consider that genetic interactions of YHL005C may vary across strain backgrounds due to epistatic relationships unique to each genetic background.

This approach has proven valuable for other yeast genes, revealing that phenotypic effects of gene deletions can vary substantially between laboratory and wild yeast strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.