Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YHR052W-A (YHR052W-A)

Shipped with Ice Packs
In Stock

Description

Key Features:

PropertyDetails
Gene NameYHR052W-A
UniProt IDP0CL32
SpeciesSaccharomyces cerevisiae (strain S288c)
Host for ExpressionE. coli (common system for recombinant production)
TagN-terminal His tag for purification
Purity>90% (verified by SDS-PAGE)

Recombinant Production

Recombinant YHR052W-A is produced using E. coli expression systems. The protein is purified via affinity chromatography and supplied in a lyophilized Tris/PBS buffer with 6% trehalose (pH 8.0) . Storage recommendations include aliquoting to avoid repeated freeze-thaw cycles and maintaining temperatures at -20°C or -80°C .

Functional Insights

While native YHR052W-A is considered non-functional, recombinant studies suggest limited roles:

  • Calcium Sensitivity Suppression: Overexpression suppresses Ca²⁺ sensitivity in mutants lacking inositol phosphorylceramide mannosyltransferases Csg1p and Csh1p .

  • Membrane Localization: Predicted to be a single-pass membrane protein, though this remains unverified experimentally .

Research Applications

Recombinant YHR052W-A is primarily used in:

  • Antibody Development: Rabbit polyclonal antibodies (e.g., MBS7151367) target this protein for ELISA and Western blot applications .

  • Protein Interaction Studies: STRING database annotations highlight weak associations with proteins like YHR054W-A (a dubious ORF) and HOR7 (a hyperosmotic stress-responsive protein) .

Limitations and Controversies

The YHR052W-A gene’s dubious status complicates its study. UniProt and SGD emphasize that comparative sequence data and experimental evidence do not support a functional role in S. cerevisiae . Recombinant versions may thus serve as negative controls or tools for probing gene annotation accuracy.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YHR052W-A; Putative uncharacterized protein YHR052W-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-64
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YHR052W-A
Target Protein Sequence
MNILKTIRFISQSSMTSWFLQTCYRRGICRRCYTPLGSYMIFGIVHYFCSYHIGIGTHDL HFGS
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.