Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YHR130C (YHR130C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid protein has a shelf life of 6 months at -20°C/-80°C. Lyophilized protein typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
YHR130C; Uncharacterized protein YHR130C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YHR130C
Target Protein Sequence
MTKSIYIIIGYMLHDEEFFYFFFISFYTLWIVFFLLHLSFFSTLSFGIFHDFDTDVYIKV GNYILHFLELSKNSNLLKNSSEMLKHFRLASLMYMYVYTQMICPSLLGIRN
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YHR130C and what do we currently know about its structure and function?

YHR130C is a putative uncharacterized protein from Saccharomyces cerevisiae with a full length of 111 amino acids. As indicated by its classification as "putative" and "uncharacterized," the specific biological functions of this protein remain largely unknown . The protein is available commercially as a recombinant full-length His-tagged protein expressed in E. coli systems, which suggests it can be successfully produced in heterologous expression systems for research purposes .

The current knowledge gap regarding YHR130C's function represents both a challenge and an opportunity for researchers. While its precise role in cellular processes remains to be elucidated, this protein represents an excellent candidate for functional characterization studies using the wealth of genetic and molecular biology tools available for S. cerevisiae research. The Saccharomyces Genome Database (SGD) at www.yeastgenome.org would be the primary resource for any existing annotations, although as an uncharacterized protein, these may be limited to sequence information and any identified genetic interactions.

Why is Saccharomyces cerevisiae an optimal host for studying uncharacterized proteins like YHR130C?

Saccharomyces cerevisiae presents numerous advantages as a host organism for studying uncharacterized proteins like YHR130C. As the first eukaryote to have its complete genome sequenced, S. cerevisiae offers a comprehensively annotated genomic database with detailed phenotypic descriptions of various mutant strains . This wealth of information facilitates a systematic approach to characterizing unknown proteins through comparative genomics and functional analysis.

The yeast system provides several specific benefits for protein characterization:

  • The Saccharomyces Genome Database (SGD) offers continuously updated annotations and phenotypic descriptions, providing a robust framework for contextualizing new functional data .

  • Complete collections of single gene deletion strains (EUROSCARF) and tetracycline-regulated essential genes are readily available, enabling high-throughput functional screening approaches .

  • S. cerevisiae has well-characterized genetics and molecular biology, with established methods for genetic manipulation and protein expression .

  • The ability to produce recombinant proteins in yeast allows for eukaryotic post-translational modifications, potentially preserving protein functionality compared to bacterial expression systems .

  • The relatively short generation time and ease of culture make S. cerevisiae particularly amenable to experimental evolution studies that might reveal functional aspects of uncharacterized proteins .

What resources and databases should researchers consult when studying YHR130C?

Researchers investigating YHR130C should leverage several key resources to maximize their understanding of this uncharacterized protein:

  • Saccharomyces Genome Database (SGD): This comprehensive database (www.yeastgenome.org) provides detailed molecular biology and genetics information for S. cerevisiae. For YHR130C, SGD would offer sequence data, any known interactions, and potential phenotypes of deletion mutants. The database is fully annotated and continuously updated, making it an indispensable resource for yeast researchers .

  • EUROSCARF Collection: This complete set of single, non-essential gene deletion strains allows researchers to determine if YHR130C deletion creates observable phenotypes under various conditions. Similarly, the collection of tetracycline-regulated essential genes from Open Biosystems provides tools to study YHR130C if it proves to be essential .

  • Protein Structure Prediction Tools: Since experimental structure determination may not be available for YHR130C, computational tools for protein structure prediction can provide insights into potential functions.

  • Interactome Databases: Resources that catalog protein-protein interactions in yeast may contain information about YHR130C's interaction partners, offering clues to its functional role .

  • Functional Genomics Datasets: Large-scale functional genomics studies, including transcriptomics and proteomics data, may reveal conditions under which YHR130C is differentially expressed or regulated.

By integrating information from these resources, researchers can develop hypotheses about YHR130C's function that can be tested experimentally.

How does the growth phase of S. cerevisiae affect the expression of proteins like YHR130C?

The growth phase of S. cerevisiae significantly impacts protein expression patterns, which has important implications for studying proteins like YHR130C. S. cerevisiae exhibits a biphasic growth pattern characterized by a respiro-fermentative phase followed by a respiratory phase, separated by the diauxic shift .

During the initial respiro-fermentative phase, glucose is primarily converted to ethanol, and cells display a higher specific growth rate. Most recombinant proteins reach their maximum yields before the diauxic shift occurs . After glucose depletion, cells enter the respiratory phase where they metabolize ethanol, with a corresponding decrease in growth rate.

For optimal expression of recombinant proteins like YHR130C, researchers should consider:

  • Harvesting cells just before the diauxic shift to maximize protein yields, which can be monitored by tracking the off-gas profile or glucose concentration in the culture .

  • Using respiratory strains like TM6*, which have improved biomass yields and consequently increased volumetric yield of recombinant proteins. These strains achieve higher biomass at the expense of ethanol production, potentially offering advantages for YHR130C expression .

  • Considering that the metabolic state of the cell affects protein folding, trafficking, and post-translational modifications, which may be crucial for studying the functional aspects of uncharacterized proteins like YHR130C.

Understanding these growth-dependent expression patterns is essential for designing experiments that aim to characterize YHR130C's function or optimize its recombinant production.

What are the basic molecular biology approaches for cloning and expressing YHR130C?

When working with YHR130C, researchers can employ established molecular biology techniques optimized for S. cerevisiae:

  • Gene Amplification: The DNA sequence encoding YHR130C can be amplified via PCR from genomic DNA or cDNA. Given its relatively small size (coding for 111 amino acids), standard PCR protocols should be effective .

  • Cloning Strategies: The amplified sequence is typically cloned into a suitable expression plasmid. For S. cerevisiae, plasmids fall into three categories, each with specific advantages depending on the research goal :

    • Integrative plasmids (YIp): Integrate into the genome for stable expression

    • Episomal plasmids (YEp): Maintain high copy numbers

    • Centromeric plasmids (YCp): Ensure low-copy stability

  • Expression Considerations: YHR130C can be expressed with or without signal sequences and fusion partners, depending on the intended protein localization and purification strategy . His-tagging has been successfully employed for YHR130C expression and purification in commercial contexts .

  • Host Strain Selection: Choosing appropriate S. cerevisiae strains is crucial. Researchers might consider strains with enhanced protein expression capabilities or those with specific genetic backgrounds that facilitate the study of YHR130C function .

  • Expression Verification: Western blotting, activity assays (if function is known), or mass spectrometry can confirm successful expression of the recombinant YHR130C protein.

These fundamental approaches provide the foundation for more advanced studies into the function and characteristics of this uncharacterized protein.

What crossing designs are optimal for studying YHR130C in experimental evolution studies?

For researchers interested in studying YHR130C through experimental evolution approaches, the crossing design significantly impacts the genetic variation available for selection. Based on research with S. cerevisiae, two main strategies can be applied:

  • Pairwise Crossing Approach ("S-type" populations):
    This method involves systematically crossing haploid strains in pairs of opposite mating types, followed by sporulation, tetrad dissection, and collection of meiotic products. Research indicates that populations constructed with this pairwise crossing approach maintain more genetic variation . The protocol involves:

    • Pairing haploid strains of opposite mating types

    • Mating and isolating successful diploid colonies

    • Sporulation in potassium acetate media

    • Tetrad dissection and verification of proper marker segregation

    • Collection of meiotic products for subsequent experiments

  • Simple Mixing Approach ("K-type" populations):
    This alternative method involves simply mixing founder strains in equal proportion. While less labor-intensive, this approach typically results in lower levels of genetic variation being maintained in the population .

For YHR130C studies, the pairwise crossing approach would be recommended, especially when:

  • The goal is to maximize genetic diversity to observe potential phenotypic effects of YHR130C variants

  • Studying the interaction of YHR130C with different genetic backgrounds

  • Investigating the evolutionary trajectory of YHR130C function under selective conditions

Additionally, increasing the number of parental strains (e.g., using 8 or 12 instead of 4) typically increases genetic diversity, enhancing the adaptive potential of the population . This approach would be particularly valuable for an uncharacterized protein like YHR130C, where diverse genetic backgrounds might reveal phenotypic effects not observable in standard laboratory strains.

How can researchers optimize the secretory pathway for improved expression of YHR130C?

Optimizing the secretory pathway is critical for enhancing the expression and potential secretion of recombinant proteins like YHR130C in S. cerevisiae. Several strategic approaches can be implemented:

  • Engineering Key Secretory Pathway Steps:
    Research has shown that targeting specific components of the secretory pathway can significantly improve recombinant protein production. For YHR130C, researchers should consider engineering:

    • Protein translocation machinery

    • Protein folding mechanisms

    • Glycosylation pathways

    • Vesicle trafficking components

  • Vesicle Transport Enhancement:
    Recombinant proteins are often retained in the secretory pathway due to transport limitations. For YHR130C, improving vesicle trafficking could be particularly beneficial since proteins are frequently bottlenecked at this stage .

  • Cell Polarization Engineering:
    Recent research indicates that engineering cell polarization can improve protein production in S. cerevisiae. This approach could be particularly relevant for enhancing YHR130C expression if the goal is to secrete the protein extracellularly or display it on the cell surface .

  • Strain Engineering Based on Transcriptional Profiling:
    Identifying specific genes with altered transcriptional profiles during high-yield recombinant protein production can guide the engineering of improved strains. Researchers have successfully applied this approach to enhance yields of other recombinant proteins, and it could be adapted for YHR130C .

  • Respiratory Strain Utilization:
    Using respiratory strains of S. cerevisiae, such as TM6*, can improve biomass yields and consequently increase volumetric yield of recombinant proteins like YHR130C .

These advanced approaches require sophisticated genetic engineering techniques but offer significant potential for improving YHR130C expression and facilitating its functional characterization.

How does the diauxic shift affect the expression and functionality of proteins like YHR130C?

The diauxic shift represents a critical metabolic transition in S. cerevisiae that substantially impacts protein expression patterns, with significant implications for studying proteins like YHR130C:

  • Metabolic Reprogramming:
    During the diauxic shift, S. cerevisiae transitions from fermentative metabolism (converting glucose to ethanol) to respiratory metabolism (utilizing ethanol as a carbon source). This transition involves extensive reprogramming of metabolic pathways and gene expression patterns, potentially affecting the expression of YHR130C depending on its regulation .

  • Optimal Harvest Timing:
    Maximum recombinant protein yields typically occur just before the diauxic shift. For experimental work with YHR130C, researchers should harvest cells before they reach the end of the respiro-fermentative phase to maximize protein yield. This timing can be precisely determined by monitoring the off-gas profile or glucose concentration in the culture .

  • Metabolic State and Protein Function:
    The metabolic state of the cell during different growth phases may affect not only the expression level but also the functionality of YHR130C. Post-translational modifications, protein folding, and subcellular localization can all be influenced by the cell's metabolic state.

  • Strain Selection Considerations:
    For studies focusing on YHR130C function or expression, researchers might consider using respiratory strains like TM6*, which demonstrate improved yield properties for both soluble and membrane proteins. These strains achieve higher biomass yields at the expense of ethanol production, potentially offering advantages for YHR130C studies .

Growth PhaseMetabolismGrowth RateRecommended for YHR130C Expression
Respiro-fermentativeGlucose → EthanolHigherYes - harvest before diauxic shift
Diauxic shiftTransition pointDecreasingNo - metabolic reprogramming occurring
RespiratoryEthanol → CO₂ + H₂OLowerNo - lower protein yields

Understanding these phase-dependent effects is crucial for experimental design when working with uncharacterized proteins like YHR130C, as they may provide insights into the protein's physiological role and optimal conditions for its study.

What approaches can be used to identify potential interaction partners of YHR130C?

Identifying interaction partners of uncharacterized proteins like YHR130C can provide crucial insights into their biological function. Several complementary approaches can be employed:

  • Yeast Two-Hybrid (Y2H) Screening:
    This classic approach can identify direct protein-protein interactions by expressing YHR130C as a bait protein fused to a DNA-binding domain and screening against a library of prey proteins fused to an activation domain. Positive interactions reconstitute a functional transcription factor, activating reporter gene expression .

  • Affinity Purification Coupled with Mass Spectrometry (AP-MS):
    By expressing tagged versions of YHR130C (such as the His-tagged version mentioned in the search results), researchers can perform pull-down experiments followed by mass spectrometry to identify co-purifying proteins. This approach can capture both direct and indirect interaction partners within protein complexes .

  • Proximity-Dependent Labeling:
    Techniques such as BioID or APEX2, where YHR130C is fused to a promiscuous biotin ligase or peroxidase, can identify proteins in close proximity in vivo, providing spatial context for potential interactions.

  • Genetic Interaction Screening:
    Systematic genetic interaction analysis, such as synthetic genetic array (SGA) analysis, can identify genes that functionally interact with YHR130C. These genetic interactions often reflect physical interactions or pathway relationships.

  • Computational Prediction:
    Leveraging existing interaction databases and computational methods to predict potential YHR130C interaction partners based on structural similarities, co-expression patterns, or evolutionary conservation.

  • Cross-Linking Mass Spectrometry:
    This technique can capture transient or weak interactions by chemically cross-linking proteins in close proximity before mass spectrometry analysis.

Each approach has distinct advantages and limitations, and a comprehensive understanding of YHR130C's interaction network would likely require a combination of these methods. The resulting interaction data would provide valuable clues about the cellular processes in which YHR130C participates.

How can genome sequencing and SNP identification aid in understanding YHR130C function?

Genome sequencing and SNP identification represent powerful approaches for elucidating the function of uncharacterized proteins like YHR130C, particularly in the context of experimental evolution studies:

  • Tracking Evolutionary Trajectories:
    In experimental evolution studies, tracking changes in the YHR130C sequence across multiple generations can reveal adaptive mutations that enhance fitness under specific selection pressures. This approach can provide insights into the protein's function by identifying which regions are under selection .

  • Population-Level Analysis:
    Sequencing recombinant populations at different timepoints (e.g., initially, after 6 cycles, and after 12 cycles of outcrossing) can reveal how genetic variation in and around the YHR130C locus is maintained or lost over time, potentially indicating functional importance .

  • Founder Strain Contributions:
    Sequencing founder strains and tracking their relative contributions to recombinant populations can reveal whether certain YHR130C alleles are preferentially maintained, suggesting functional advantages .

  • SNP Impact Assessment:
    Identifying SNPs in the YHR130C sequence across different yeast strains and correlating them with phenotypic differences can provide clues to functionally important residues or domains.

  • Linkage Disequilibrium Analysis:
    Analyzing patterns of linkage disequilibrium around YHR130C can reveal genetic hitchhiking effects, potentially indicating selection on YHR130C or nearby loci.

In practical implementation, researchers could:

  • Create synthetic recombinant populations using the pairwise crossing approach

  • Subject these populations to conditions hypothesized to involve YHR130C function

  • Sequence populations at multiple timepoints (e.g., cycles 0, 6, and 12)

  • Analyze SNP patterns and allele frequencies in the YHR130C region

  • Correlate genetic changes with phenotypic outcomes

This approach has proven valuable for understanding gene function in evolution experiments with S. cerevisiae and could be particularly illuminating for uncharacterized proteins like YHR130C .

What are the optimal conditions for inducing and measuring YHR130C expression?

Optimizing conditions for YHR130C expression requires careful consideration of several key parameters:

  • Promoter Selection:
    The choice of promoter significantly impacts expression levels. For initial characterization, researchers might consider:

    • Constitutive promoters (e.g., TEF1, GPD) for continuous expression

    • Inducible promoters (e.g., GAL1, CUP1) for controlled expression timing

    • Native YHR130C promoter to maintain physiological regulation

  • Growth Medium and Conditions:

    • For maximum recombinant protein yields, cells should be harvested just before the diauxic shift, which can be monitored by tracking glucose concentration or off-gas profile

    • Consider testing both rich media (YPD) and defined minimal media to determine optimal conditions for YHR130C expression

    • Temperature optimization may be necessary, with lower temperatures (20-25°C) sometimes improving protein folding

  • Expression Monitoring:

    • Western blotting using antibodies against fusion tags (e.g., His-tag) can confirm expression

    • Fluorescent protein fusions may allow real-time monitoring of expression and localization

    • qRT-PCR can quantify transcript levels under different conditions

  • Strain Considerations:

    • Respiratory strains like TM6* may provide improved yields through higher biomass production

    • Protease-deficient strains can reduce degradation of recombinant proteins

    • Consider strains with enhanced secretory capacity if YHR130C is to be secreted

  • Experimental Design for Expression Studies:

    • Include appropriate positive controls (known highly expressed proteins)

    • Monitor cell density and viability to ensure expression doesn't negatively impact growth

    • Consider time-course experiments to determine optimal induction and harvest times

By systematically optimizing these parameters, researchers can establish reliable protocols for YHR130C expression, facilitating subsequent functional characterization studies.

What purification strategies are most effective for recombinant YHR130C protein?

Purifying recombinant YHR130C requires careful selection of purification strategies based on the protein's properties and expression system. Several approaches can be considered:

  • Affinity Chromatography:

    • His-tag purification: YHR130C has been successfully produced as a His-tagged protein , allowing for immobilized metal affinity chromatography (IMAC) purification using Ni-NTA or similar resins

    • Other affinity tags like GST, MBP, or FLAG can be considered depending on experimental needs and protein characteristics

  • Size Exclusion Chromatography:

    • Useful as a secondary purification step to separate YHR130C monomers from aggregates or other proteins of different sizes

    • Can also provide information about the oligomeric state of YHR130C

  • Ion Exchange Chromatography:

    • Based on the predicted isoelectric point of YHR130C, either cation or anion exchange chromatography can be employed

    • Particularly useful if affinity tags are not used or have been removed

  • Secretion-Based Strategies:

    • If YHR130C can be engineered for secretion, this simplifies purification as the protein can be isolated from the culture medium

    • Requires optimization of the secretory pathway as discussed in section 2.2

  • On-Column Refolding:

    • If YHR130C forms inclusion bodies during expression, on-column refolding during affinity purification might be necessary

  • Tag Removal:

    • For functional studies, consider introducing a protease cleavage site between YHR130C and any affinity tags

    • Common proteases include TEV, PreScission, and thrombin

Each purification approach should be optimized based on the specific properties of YHR130C, including its size (111 amino acids), stability, solubility, and potential interacting partners. A multi-step purification strategy combining complementary techniques typically yields the highest purity.

What analytical methods are most suitable for characterizing the structure and function of YHR130C?

Given YHR130C's status as a putative uncharacterized protein, a comprehensive analytical approach is necessary to elucidate its structure and function:

  • Structural Characterization:

    • X-ray crystallography: If crystals can be obtained, this provides high-resolution structural information

    • NMR spectroscopy: Particularly suitable for smaller proteins like YHR130C (111 amino acids), providing both structural and dynamic information

    • Circular dichroism (CD): Offers insights into secondary structure content (α-helices, β-sheets)

    • Small-angle X-ray scattering (SAXS): Provides low-resolution structural information in solution

    • Cryo-electron microscopy: If YHR130C forms part of a larger complex

  • Functional Analysis:

    • Phenotypic analysis of deletion/overexpression strains under various conditions

    • Protein-protein interaction studies as outlined in section 2.4

    • Subcellular localization using fluorescent protein fusions or immunofluorescence

    • Metabolomic analysis comparing wild-type and YHR130C mutant strains

    • Transcriptomic profiling to identify pathways affected by YHR130C manipulation

  • Biochemical Characterization:

    • Enzymatic activity assays based on predicted functions or structural homology

    • Binding assays to identify potential substrates, cofactors, or interaction partners

    • Post-translational modification analysis using mass spectrometry

    • Stability and folding studies using differential scanning fluorimetry or similar techniques

  • Computational Approaches:

    • Homology modeling based on structural similarities to characterized proteins

    • Molecular dynamics simulations to predict functional sites

    • Evolutionary analysis to identify conserved regions likely important for function

  • Genetic Approaches:

    • Synthetic genetic interaction screening to identify functional relationships

    • Suppressor screens to identify genes that can compensate for YHR130C deletion

    • CRISPR-based mutagenesis to systematically probe the function of different protein regions

This multi-faceted analytical approach provides complementary data that, when integrated, can provide significant insights into the structure and function of this uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.