Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YIM2 (YIM2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
YIM2; YMR151W; YM9375.21; Putative uncharacterized protein YIM2; RF435
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YIM2
Target Protein Sequence
MGSVPTVIPGIVHCWMIHCLIGPFLFAIIYWSIFIEGMFFPQKYLDCQSVINLLCGSNQQ KRIFKEKLRIYQVHIQEKIGCSKFNTLLLIYQLGSRHKINRQINDLLCNLCSKNYMIMLL YAEIIIYSSFSCVLSATIFLRGFLL
Uniprot No.

Target Background

Database Links

STRING: 4932.YMR151W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What methodologies are most effective for identifying the cellular localization of YIM2 in S. cerevisiae?

Localization studies provide critical insights into protein function. For YIM2, a fluorescence-based approach using GFP fusion proteins has proven effective. Based on methodologies for identifying novel mitochondrially localized proteins, a technique utilizing a rapidly degraded fluorescent protein (GFPdeg) can be particularly valuable for YIM2 characterization.

The GFPdeg system works by fusing GFPdeg to YIM2, where the fluorescent protein is rapidly degraded in the cytoplasm but protected within organelles. This approach allowed researchers to identify 35 uncharacterized proteins potentially localized to mitochondria in S. cerevisiae, many of which lacked conventional N-terminal mitochondrial localization signals .

A complementary approach involves the CellASIC ONIX Microfluidic Platform, which enables monitoring of protein localization changes in individual aging yeast cells. This system maintains cells in a monolayer and can be combined with the Mother Enrichment Program (MEP) to track protein dynamics throughout cellular aging .

Table 1: Comparison of Protein Localization Methods for Uncharacterized Proteins

MethodAdvantagesLimitationsApplication to YIM2
GFPdeg fusionRapid degradation in cytoplasm; protection in organellesPotential interference with protein functionDetermine if YIM2 localizes to specific organelles
CellASIC microfluidic platformAllows real-time monitoring; tracks aging-related changesRequires specialized equipmentMonitor YIM2 localization changes during cell aging
Immunofluorescence Assay (IFA)No genetic modification needed; uses specific antibodiesLess dynamic information; fixed samplesConfirm localization with alternative to GFP fusion
Subcellular fractionationBiochemical verification of localizationLabor-intensive; potential contaminationValidate GFP findings with biochemical evidence

How can researchers distinguish between truly uncharacterized proteins like YIM2 and proteins with partial functional annotations?

Distinguishing truly uncharacterized proteins requires thorough database screening and bioinformatic analysis. For YIM2, researchers should:

  • Screen yeast databases including SGD (Saccharomyces Genome Database) and GO (Gene Ontology) for any existing functional annotations .

  • Apply prediction tools like DeepLoc-1.0, which has been successfully used to predict mitochondrial localization of uncharacterized proteins in yeast .

  • Examine evolutionary conservation patterns, noting that many uncharacterized proteins in S. cerevisiae (like those identified in mitochondrial studies) are "emerging genes" that exist only in S. cerevisiae and lack orthologs in other species .

  • Analyze expression patterns during specific cellular states. For example, some uncharacterized proteins show upregulation during the postdiauxic shift phase when mitochondria are developing, suggesting functional relevance .

What are the optimal conditions for expressing recombinant YIM2 protein in S. cerevisiae?

Expression of recombinant proteins in S. cerevisiae offers advantages of a eukaryotic host with clear genetic background and efficient protein expression systems. For optimal YIM2 expression:

  • Select an appropriate expression system: Genome integration approaches create more stable expression compared to plasmid-based systems. As demonstrated with other yeast proteins, integrating the expression cassette into the genome provides consistent protein levels across generations .

  • Choose an effective promoter: The strength and regulation of the promoter significantly impacts expression levels. For initial characterization, constitutive promoters like PGPD or PTEF1 provide consistent expression, while inducible promoters like PGAL1 offer control over expression timing .

  • Consider codon optimization: While S. cerevisiae expressing its native YIM2 wouldn't require codon optimization, the sequence should be verified for any rare codons that might limit expression efficiency.

  • Optimize culture conditions: Standard conditions include growth at 30°C in YPD medium or selective medium for plasmid maintenance. For protein induction using galactose-inducible promoters, a carbon source shift from glucose to galactose is necessary .

Table 2: Expression Systems for Recombinant Proteins in S. cerevisiae

Expression SystemFeaturesApplication for YIM2
Genome integrationStable expression; consistent protein levelsLong-term studies of YIM2 function
Surface display (Aga2 fusion)Displays protein on cell surface; accessible for interaction studiesStudy YIM2 interactions with other proteins or ligands
Secretion systemAllows protein collection from mediaPurification of YIM2 for structural studies
Inducible expressionControlled timing of expressionStudy effects of YIM2 overexpression

What purification strategies are most effective for isolating recombinant YIM2 protein?

Purification of YIM2 should be tailored to the protein's predicted characteristics and experimental goals:

  • Affinity tagging: Adding a tag such as His6, FLAG, or TAP (Tandem Affinity Purification) facilitates purification. TAP tagging has been successfully used for purifying yeast proteins involved in translation and ribosome-associated functions .

  • Subcellular fractionation: If YIM2 associates with particular cellular structures or organelles, fractionation before purification improves yield and purity. For ribosome-associated proteins, sucrose gradient fractionation has proven effective .

  • Column chromatography: Ion exchange, hydrophobic interaction, or size exclusion chromatography can be employed as secondary purification steps based on the physicochemical properties of YIM2.

For TAP purification specifically, researchers have effectively purified uncharacterized yeast proteins by:

  • Growing cells to mid-log phase

  • Harvesting and lysing cells in appropriate buffer conditions

  • Binding to IgG sepharose

  • TEV protease cleavage

  • Secondary binding to calmodulin resin

  • Elution with EGTA

How can researchers determine if YIM2 has a role in cellular translation machinery?

Based on methodologies used for identifying Translation Machinery-Associated (TMA) proteins, the following approaches can determine if YIM2 functions in translation:

  • Ribosome association assays: Analyze YIM2 cosedimentation with ribosomes in sucrose gradients. Examination of YIM2 distribution across 40S, 60S, 80S, and polysome fractions can indicate association with translation machinery .

  • Translation rate measurements: Compare protein synthesis rates in wild-type and YIM2 deletion strains using 35S-methionine incorporation assays. Significant decreases in incorporation would suggest YIM2 involvement in translation .

  • Translation fidelity assays: Measure nonsense suppression or frameshifting using reporter constructs containing in-frame nonsense mutations. Altered read-through in YIM2 mutants would indicate a role in translation accuracy .

  • Drug susceptibility testing: Test YIM2 deletion strains for altered sensitivity to translation inhibitors like cycloheximide, anisomycin, or rapamycin. Enhanced sensitivity would suggest YIM2 functions in translation .

  • Polysome profile analysis: Examine polysome profiles in YIM2 deletion strains. Alterations in polysome/monosome ratios would indicate translation initiation or elongation defects .

Table 3: Translation-Related Functional Assays Applicable to YIM2

AssayMeasurementInterpretation for YIM2
35S-methionine incorporationProtein synthesis rateDecreased incorporation in ΔyIM2 suggests role in translation efficiency
Nonsense suppressionRead-through of premature stop codonsIncreased read-through suggests role in translation fidelity
Drug sensitivityGrowth in presence of translation inhibitorsHypersensitivity suggests involvement in targeted pathway
Polysome profilingRatio of polysomes to monosomesAltered profiles indicate specific translation process defects
TAP-MS interaction studiesProteins co-purifying with YIM2Association with known translation factors suggests related function

What approaches can identify potential protein interaction partners of YIM2?

Identifying YIM2 interaction partners provides critical functional insights. Effective approaches include:

  • Tandem Affinity Purification coupled with Mass Spectrometry (TAP-MS): This method has successfully identified interaction networks for uncharacterized yeast proteins. By creating a TAP-tagged YIM2 fusion protein, researchers can purify YIM2 complexes and identify co-purifying proteins through mass spectrometry .

  • Yeast two-hybrid (Y2H) screening: While not mentioned directly in the search results, Y2H can identify direct protein-protein interactions. This approach has identified interactions between LSM12 and PBP1 in previous studies .

  • Proximity-based labeling approaches: BioID or APEX2 fusion proteins can identify proteins in close proximity to YIM2 in living cells.

  • Co-immunoprecipitation with specific antibodies: If antibodies against YIM2 are available, direct immunoprecipitation followed by mass spectrometry can identify interacting partners.

For TAP-MS specifically, calculating Relative Abundance Factors (RAFs) helps distinguish true interactors from background contaminants. RAFs are calculated by dividing the average Protein Abundance Factor (PAF) in the TAP purification by the average PAF in control purifications .

What phenotypic assays are most informative when characterizing YIM2 deletion mutants?

Phenotypic characterization of ΔyIM2 strains should include:

  • Growth rate analysis: Compare doubling times of wild-type and ΔyIM2 strains under various conditions (different carbon sources, temperatures, stress conditions).

  • Stress response assays: Test sensitivity to oxidative stress (H₂O₂), osmotic stress (NaCl, sorbitol), heat shock, and nutrient limitation.

  • Cell cycle analysis: Examine potential defects in cell cycle progression using flow cytometry or microscopic observation of synchronized cultures.

  • Aging phenotypes: Use microfluidic platforms like CellASIC ONIX to track replicative lifespan of individual ΔyIM2 cells compared to wild-type .

  • Translation-specific phenotypes: If preliminary data suggests translation involvement, perform specialized assays as described in question 3.1.

The approach should be systematic and include appropriate controls. For example, when studying TMA proteins, researchers included a deletion strain for the translation initiation factor FUN12 (eIF5B) as a control, which showed 5% of wild-type 35S-methionine incorporation .

How can researchers determine if YIM2 function is evolutionarily conserved?

Evolutionary conservation analysis requires:

  • Sequence homology searches: Use tools like BLAST, PSI-BLAST, or HHpred to identify potential homologs in other species. For uncharacterized mitochondrial proteins in yeast, many were found to be "emerging genes" existing only in S. cerevisiae .

  • Structural prediction comparison: Use AlphaFold or similar tools to predict structures of YIM2 and potential homologs, then compare structural similarities even when sequence homology is low.

  • Complementation studies: Express potential homologs in ΔyIM2 yeast strains to test functional complementation. This approach successfully demonstrated that human MCT-1 functions in translation-related processes by complementing translation defects in Δtma20 yeast .

  • Interaction conservation: Compare interaction partners of YIM2 and potential homologs to identify conserved interaction networks.

Table 4: Complementation Testing for Functional Conservation

ApproachMethodologyApplication to YIM2
Heterologous expressionExpress potential homologs in ΔyIM2 strainDetermine if homologs can rescue ΔyIM2 phenotypes
Domain swappingCreate chimeric proteins with domains from YIM2 and homologsIdentify functionally conserved domains
Conserved interaction testingTest if homologs interact with the same partners as YIM2Determine conservation of molecular function
Localization comparisonCompare subcellular localization of YIM2 and homologsAssess conservation of cellular context

How should researchers approach data management and sharing for YIM2 characterization studies according to FAIR principles?

Adhering to FAIR (Findability, Accessibility, Interoperability, and Reusability) principles ensures that YIM2 research data becomes maximally valuable to the scientific community :

  • Findability:

    • Assign persistent identifiers (PIDs) like DOIs to datasets

    • Create rich metadata that thoroughly describes YIM2 experimental conditions, strain information, and methodologies

    • Register datasets in searchable repositories specific to yeast research

  • Accessibility:

    • Deposit data in repositories with stable URLs that allow long-term access

    • Ensure clear permission conditions while making data as open as possible

    • Provide data in both human-readable and machine-readable formats

  • Interoperability:

    • Use standard formats for sequence data (FASTA), microscopy images, mass spectrometry results

    • Adhere to community standards like the Minimum Information About a Proteomics Experiment (MIAPE)

    • Include cross-references to common identifiers in SGD and UniProt

  • Reusability:

    • Provide detailed protocols and parameter settings

    • Include negative results and control experiments

    • Apply appropriate licenses that promote reuse while ensuring proper attribution

For YIM2 specifically, researchers should consider depositing:

  • Sequence and expression data in GEO or ArrayExpress

  • Interaction data in BioGRID or IntAct

  • Localization images in the Image Data Resource

  • Structural data in PDB if structures are determined

How can researchers address contradictory findings about YIM2 function in the scientific literature?

When confronted with contradictory findings about YIM2 function, researchers should:

  • Systematically evaluate methodological differences:

    • Compare experimental conditions (strain backgrounds, media, growth conditions)

    • Assess different tagging strategies that might affect protein function

    • Examine differences in protein expression levels

  • Develop a standardized NLI (Natural Language Inference) framework to identify contradictory claims, similar to approaches used for COVID-19 drug efficacy claims . This could include:

    • Systematic extraction of claims about YIM2 from literature

    • Classification of claims as contradictory or corroborating

    • Identification of potential sources of discrepancy

  • Conduct definitive experiments that directly test contradictory hypotheses using:

    • Multiple complementary techniques

    • Collaboration with labs reporting conflicting results

    • Careful control of variables that might explain differences

  • Consider context-dependent function:

    • Test if YIM2 has different functions under different conditions

    • Examine if YIM2 interacts with different partners in different cellular contexts

    • Investigate if post-translational modifications alter YIM2 function

  • Develop quantitative models that might reconcile apparently contradictory findings by incorporating:

    • Kinetic parameters

    • Concentration-dependent effects

    • Stochastic influences

How might YIM2 be utilized in the development of alternative protein applications?

The exploration of YIM2 in alternative protein applications represents an emerging research direction:

  • If YIM2 proves to have unique properties, it could be incorporated into the alternative protein ecosystem being developed through initiatives like the Alt Protein Project . Potential applications include:

    • Using YIM2 as a component in fermentation-enabled protein products

    • Engineering YIM2 for improved functionality in food applications

    • Developing YIM2 variants with enhanced nutritional profiles

  • If YIM2 is found to affect protein expression or folding, it could be exploited to enhance recombinant protein production in yeast for food applications. This builds upon S. cerevisiae's established safety record as a GRAS (Generally Recognized As Safe) organism .

  • Interdisciplinary collaborations between molecular biologists characterizing YIM2 and food scientists could accelerate application development:

    • Tissue engineers could explore YIM2's potential effects on protein structure

    • Food scientists could evaluate sensory and functional properties

    • Bioprocess engineers could optimize fermentation conditions

The Alt Protein Project's framework of connecting research across disciplines provides a model for developing YIM2 applications if its functionality proves relevant to alternative protein development .

What role might YIM2 play in understanding cellular aging and lifespan regulation in yeast?

Understanding YIM2's potential role in aging requires:

  • Lifespan analysis using microfluidic platforms like CellASIC ONIX, which can track individual yeast cells throughout their replicative lifespan . This could reveal if:

    • YIM2 expression changes with cellular age

    • YIM2 localization shifts during aging

    • ΔyIM2 cells show altered lifespan

  • Investigation of YIM2 interaction with known lifespan regulators:

    • Examine potential interactions with TORC1 complex components

    • Test if YIM2 influences response to rapamycin, a lifespan-extending compound

    • Assess if caloric restriction affects YIM2 function

  • If YIM2 localizes to mitochondria as some uncharacterized proteins do , examine its role in:

    • Mitochondrial function during aging

    • Response to oxidative stress

    • Mitochondrial dynamics and quality control

  • Compare findings to recent research on TORC1 complexes in yeast, which revealed distinct roles for different complex types in stress response and lifespan regulation .

Table 5: Experimental Approaches to Study YIM2 in Aging

ApproachMethodologyExpected Outcome
Age-dependent expressionTrack GFP-YIM2 levels throughout lifespanDetermine if YIM2 expression changes with age
Lifespan analysisMonitor replicative lifespan of ΔyIM2 cellsAssess if YIM2 affects longevity
Stress resistanceTest aged ΔyIM2 cells for stress sensitivityDetermine if YIM2 affects age-dependent stress response
Epistasis analysisCreate double mutants with known aging genesPosition YIM2 in aging pathways
Caloric restriction responseCompare CR effects in wild-type and ΔyIM2Determine if YIM2 mediates CR benefits

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.