Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YIR043C (YIR043C)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YIR043C (YIR043C)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YIR043C (YIR043C) is a transmembrane protein expressed in E. coli as a recombinant product. It is annotated as a full-length protein (1–230 amino acids) with an N-terminal 10xHis-tag for purification and detection . While its biological function remains uncharacterized, it belongs to the conserved Cos protein family, often encoded in subtelomeric regions of yeast genomes . Below is a detailed analysis of its structural, production, and functional characteristics.

Recombinant Expression

YIR043C is produced via bacterial expression systems in E. coli, followed by purification using nickel affinity chromatography due to its His-tag . The protein is lyophilized or stored in Tris/PBS-based buffers with 6% trehalose and 50% glycerol to enhance stability .

Lack of Functional Annotations

No Gene Ontology (GO) annotations are available for molecular function, biological process, or cellular component . This reflects insufficient experimental data to assign definitive roles.

Potential Applications

  • Structural Studies: Used in SDS-PAGE for purity assessment .

  • Interaction Mapping: Serves as a bait in yeast two-hybrid or co-immunoprecipitation assays .

Research Gaps

  • Functional Characterization: No evidence of enzymatic activity or interaction partners has been reported .

  • Biological Relevance: The protein’s association with the Cos family remains speculative due to the absence of functional studies .

Recommendations for Future Studies

  1. Localization Assays: Determine subcellular localization (e.g., membrane, cytoplasm).

  2. Phylogenetic Analysis: Compare YIR043C with homologs in other yeast species to infer evolutionary conservation.

  3. High-Throughput Screening: Test for interactions with yeast proteins or pathways (e.g., ER stress, membrane trafficking).

Product Variants

VendorProduct CodeFormPurityPrice Range
CusabioCSB-CF328141SVGLyophilized>90%~€1,578
Creative BioMartRFL28971SFLyophilized>90%Inquiry-based
MyBioSourceMBS7059965Lyophilized/Liquid≥85%~$500–$1,500

Prices vary based on batch size and customization (e.g., tag modifications, endotoxin reduction) .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YIR043C; YI8224.05C; Putative uncharacterized protein YIR043C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YIR043C
Target Protein Sequence
MGCQEAFRTTLLEPFSLKKDEAAKVKSFKDSVSYIEEALGVYFTEVEKQWKLFNTEKSWS PVGLEDAKLPKEAYRFKLTWILKRIFKLRCLQVFLYYFLIVYTSGNVDLISRFLFPVVMF FIMTRDFQNMGMIVLSVKMEHKMQFLSTIINEQESGANGWDEIAKKMNRYLFEKKVWNNE EFFYDGLDCEWFFSCFFYRLLSLKKTMWFASLNVELWPYVKEAQSVVTSL
Uniprot No.

Target Background

Protein Families
DUP/COS family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the basic expression systems for recombinant YIR043C production?

Recombinant YIR043C can be produced using several expression systems, each with distinct advantages:

  • E. coli expression systems: Most commonly used due to rapid growth, high protein yields, and ease of genetic manipulation. Based on the search results, E. coli has been used successfully for YIR043C expression .

  • Native S. cerevisiae expression: Useful for studying protein in its natural environment with appropriate post-translational modifications.

  • Other yeast expression systems: Pichia pastoris can be used for higher eukaryotic protein expression with proper folding.

Methodology for basic E. coli expression:

  • Clone the YIR043C gene into an appropriate expression vector (e.g., pGAPZαC as mentioned in search result #2)

  • Transform into E. coli expression strain

  • Induce protein expression using appropriate conditions

  • Harvest cells and lyse to extract protein

  • Purify using affinity chromatography (His-tag appears to be commonly used with YIR043C)

What basic structural features have been identified in YIR043C?

Although YIR043C remains largely uncharacterized, preliminary structural analysis reveals:

  • 230 amino acid length protein

  • Potential membrane-associated features suggested by hydrophobic domains in its sequence

  • No clearly identified enzymatic domains or motifs in public databases

  • May contain transmembrane regions as suggested by the hydrophobic amino acid sequences ("FLIVYTSGNVDLISRFLFPVVMFFIMTR")

For researchers beginning work with YIR043C, basic structural prediction tools like PSIPRED, TMHMM, or SignalP can provide initial insights into secondary structure, transmembrane domains, and signal peptides, respectively.

What are the most effective experimental approaches to determine the function of YIR043C?

Determining the function of uncharacterized proteins like YIR043C requires multiple complementary approaches:

Genetic Approaches:

  • Gene knockout/deletion: Generate ΔYIR043C strains to observe phenotypic changes. This can be accomplished using homologous recombination methods detailed in search result #3, which describes using PCR products for targeted gene replacement in S. cerevisiae.

  • Overexpression studies: Similar to the approach with other yeast genes described in search result #2, where overexpression vectors were constructed to study protein function.

  • Complementation tests: If knockout shows phenotype, complementation with wild-type or mutant versions can confirm specificity.

Biochemical Approaches:

  • Protein-protein interaction studies: Yeast two-hybrid, co-immunoprecipitation, or pull-down assays to identify interacting partners.

  • Subcellular localization: GFP-tagging and microscopy to determine where YIR043C localizes within the cell.

  • Post-translational modification analysis: Mass spectrometry to identify phosphorylation, glycosylation, or other modifications.

Comparative Genomics:

  • Ortholog analysis: Identify potential orthologs in other species that may have known functions.

  • Synteny analysis: Examine conservation of genomic context across related species.

How can researchers effectively integrate YIR043C into studies of silent chromatin and gene regulation in yeast?

Based on search result #3 about Sir proteins and chromatin silencing in S. cerevisiae, researchers might investigate potential connections between YIR043C and chromatin regulation:

Methodological approach:

  • Perform ChIP-seq experiments to determine if YIR043C associates with specific chromatin regions

  • Analyze genetic interactions between YIR043C and known chromatin regulators (Sir2, Sir3, Sir4)

  • Examine YIR043C expression changes in response to histone modifications (H4K16 acetylation, H3K79 methylation)

  • Test for physical interactions between YIR043C and chromatin-modifying enzymes

Researchers should specifically investigate:

  • If YIR043C localizes to silent chromatin regions (telomeres, HM loci)

  • Whether YIR043C knockout affects gene silencing

  • If YIR043C interacts with or influences the activity of Sir proteins

What advanced genetic manipulation techniques are most appropriate for studying YIR043C function in S. cerevisiae?

CRISPR-Cas9 System for Precise Gene Editing:

  • Design guide RNAs targeting YIR043C

  • Introduce Cas9 and guide RNA expression cassettes into yeast cells

  • Provide a repair template for desired modifications

  • Select and verify transformants

Site-Directed Mutagenesis for Structure-Function Analysis:

  • Identify conserved residues or predicted functional domains

  • Generate a panel of point mutations

  • Transform mutant constructs into appropriate yeast strains

  • Assess functional consequences of each mutation

Promoter Replacement for Controlled Expression:

  • Replace native YIR043C promoter with inducible promoter (e.g., GAL1)

  • Enable temporal control of gene expression

  • Monitor phenotypic changes upon induction/repression

Integration of Reporter Genes:

  • Fuse YIR043C to fluorescent proteins or epitope tags

  • Integrate constructs at native locus to maintain normal regulation

  • Use for real-time visualization or biochemical purification

How can researchers leverage RNA-mediated processes to study YIR043C function in relation to disease models?

Based on search result #1 highlighting S. cerevisiae as a model for RNA-mediated disease processes:

Methodology for RNA-focused investigation of YIR043C:

  • Analyze if YIR043C functions in RNA metabolism or regulation

    • RNA immunoprecipitation to identify bound RNAs

    • Analysis of RNA processing defects in YIR043C mutants

    • Assessment of YIR043C impact on RNA stability or translation

  • Develop disease-relevant models:

    • If YIR043C has human homologs, investigate connection to RNA-related diseases

    • Create yeast strains expressing human disease-associated proteins to study genetic interactions with YIR043C

    • Use yeast as a screening platform for compounds affecting YIR043C and related pathways

  • Investigate potential roles in stress response:

    • As noted in search result #1, yeast models are valuable for studying various stresses including neurodegeneration and aging

    • Test if YIR043C is involved in stress granule formation or other RNA-based stress responses

What are the most sensitive analytical techniques for detecting interactions between YIR043C and cellular metabolic pathways?

Metabolomic Analysis:

  • Compare metabolite profiles between wild-type and ΔYIR043C strains using:

    • Liquid chromatography-mass spectrometry (LC-MS)

    • Gas chromatography-mass spectrometry (GC-MS)

    • Nuclear magnetic resonance (NMR) spectroscopy

  • Flux analysis using stable isotope labeling:

    • Culture yeast with 13C-labeled carbon sources

    • Track isotope incorporation into metabolites

    • Identify metabolic pathways affected by YIR043C

Integration with Transcriptomic and Proteomic Data:

  • Perform RNA-Seq on ΔYIR043C strains to identify gene expression changes

  • Conduct proteomics analysis to detect altered protein levels

  • Integrate multi-omics data to identify affected pathways

Enzyme Assay Development:

  • Test if YIR043C has enzymatic activity:

    • Develop in vitro assays with purified protein

    • Screen against potential substrates

    • Measure kinetic parameters

What are the optimal conditions for expression and purification of recombinant YIR043C for structural studies?

Expression Optimization:

ParameterRecommended ConditionsAlternatives to Test
Expression SystemE. coli BL21(DE3)Rosetta(DE3), Arctic Express
Expression VectorpET with His-tagGST fusion, MBP fusion
Induction0.5 mM IPTG, 18°C, 16hAuto-induction media
MediaLB with glucoseTerrific Broth, Minimal media
Cell lysisSonication in Tris bufferFrench press, detergent lysis

Purification Strategy:

  • Immobilized metal affinity chromatography (IMAC) using His-tag

  • Size exclusion chromatography to ensure monodispersity

  • Ion exchange chromatography for final polishing

Stability Screening:
Test multiple buffer conditions (varying pH, salt concentration, additives) using differential scanning fluorimetry to identify conditions that maximize protein stability.

Structural Analysis Approaches:

  • X-ray crystallography: Screen crystallization conditions using commercial kits

  • Cryo-EM: For potential protein complexes

  • NMR: For dynamic regions or if crystallization proves challenging

How can researchers effectively design experiments to resolve contradictory data about YIR043C function?

When facing contradictory data regarding YIR043C function, a systematic approach is essential:

Methodological framework for resolving contradictions:

  • Replicate original experiments with careful attention to:

    • Strain background variations (S288C vs. other laboratory strains)

    • Growth conditions and media composition

    • Precise experimental protocols and reagents

  • Perform epistasis analysis:

    • Create double mutants between YIR043C and genes in suspected pathways

    • Analyze genetic interactions (synthetic lethality, suppression)

    • Compare phenotypic outcomes to single mutants

  • Use orthogonal techniques to confirm findings:

    • If functional data came from genetic studies, confirm with biochemical approaches

    • If protein interaction data seems contradictory, use multiple interaction methods

    • Implement CRISPR interference or other acute depletion methods alongside knockout studies

  • Control for indirect effects:

    • Test for general stress responses

    • Measure growth rates to account for secondary effects

    • Use time-course experiments to distinguish primary from secondary effects

  • Consider post-translational modifications:

    • Examine if contradictory results might be explained by different modification states

    • Test if function depends on specific conditions that might affect modifications

What considerations are important when designing genome-wide screens to identify genetic interactions with YIR043C?

Design Principles for Genetic Interaction Screens:

  • Selection of appropriate screening method:

    • Synthetic genetic array (SGA) analysis: Systematic creation of double mutants

    • Multicopy suppressor screens: Identify genes that rescue YIR043C mutant phenotypes

    • CRISPR-based screens: Higher precision for partial loss-of-function studies

  • Control design:

    • Include positive controls (genes known to interact with similar pathways)

    • Include negative controls (genes in unrelated pathways)

    • Use multiple alleles of YIR043C (null, hypomorphic, tagged versions)

  • Growth conditions:

    • Test multiple environmental conditions (temperature, carbon source, stress)

    • Include conditions that might reveal conditional phenotypes

  • Data analysis framework:

    • Define appropriate statistical thresholds for interactions

    • Use computational methods to identify enriched pathways and processes

    • Compare results to existing genetic interaction networks

  • Validation strategies:

    • Secondary screens with orthogonal methods

    • Detailed phenotypic characterization of top hits

    • Biochemical validation of physical interactions

How can researchers leverage YIR043C studies to understand evolutionary conservation of uncharacterized proteins across species?

Methodological approach for evolutionary studies:

  • Comprehensive sequence analysis:

    • Perform sensitive sequence searches (PSI-BLAST, HHpred) to identify distant homologs

    • Analyze sequence conservation patterns across fungal species

    • Create multiple sequence alignments to identify conserved residues

  • Structural prediction analysis:

    • Use AlphaFold or RoseTTAFold to predict YIR043C structure

    • Compare predicted structural features across species

    • Identify potential functional domains based on structural conservation

  • Functional complementation experiments:

    • Clone potential homologs from other species

    • Test if they can complement YIR043C deletion in S. cerevisiae

    • Analyze domain-swapping constructs to identify functionally conserved regions

  • Comparative genomics:

    • Analyze genomic context of YIR043C homologs across species

    • Identify conserved synteny or operon-like arrangements

    • Examine co-evolution with interacting partners

  • Comparative expression analysis:

    • Compare expression patterns of homologs across species

    • Identify conserved regulatory elements

    • Test if expression is responsive to similar conditions across species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.