Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJL007C (YJL007C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
YJL007C; J1379; Uncharacterized protein YJL007C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJL007C
Target Protein Sequence
MCSRGGSNSRPSDYETDALPTELLKHTKDVGEEKQTLHQIFADSMVIKGYSTGYTGHTRS SPGDLVIHKRELIFSHNIVIIVSPIYMISFIILLHYQSWHFSIY
Uniprot No.

Target Background

Database Links

STRING: 4932.YJL007C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YJL007C and why is it significant for research?

YJL007C is a putative uncharacterized protein in Saccharomyces cerevisiae, identified through genome sequencing but lacking comprehensive functional characterization. Its significance stems from S. cerevisiae's position as a premier eukaryotic model organism with a fully sequenced genome. Uncharacterized yeast proteins represent opportunities to discover novel biological functions that may be conserved across eukaryotes. S. cerevisiae has proven invaluable for studying fundamental cellular processes including aging, gene expression regulation, signal transduction, cell cycle, metabolism, and apoptosis . Research on YJL007C contributes to completing our understanding of the yeast proteome and potentially reveals new insights into eukaryotic cellular function.

What bioinformatic approaches are recommended for initial characterization of YJL007C?

Initial characterization should employ multiple complementary bioinformatic approaches:

  • Sequence homology analysis: Compare YJL007C against protein databases using BLAST and PSI-BLAST to identify potential homologs across species. This helps establish evolutionary conservation and possible functional clues.

  • Protein domain prediction: Use tools like PFAM, SMART, and InterPro to identify conserved domains that might suggest molecular function.

  • Secondary structure prediction: Programs like PSIPRED and JPred can predict structural elements that may provide functional insights.

  • Ortholog identification: Create clusters of orthologs (COGs) as described in comparative genomics approaches to identify evolutionary relationships . This is particularly valuable since no S. cerevisiae protein has orthologs in all organisms, but targeted comparison with specific taxa can reveal significant functional conservation.

  • Functional network analysis: Integrate protein-protein interaction data, co-expression patterns, and genetic interaction screens to position YJL007C within cellular networks.

The combination of these approaches provides a foundation for hypothesis generation regarding YJL007C function that can guide experimental design.

How can I confirm the expression of YJL007C in various growth conditions?

Confirmation of YJL007C expression requires complementary approaches:

RT-qPCR methodology:

  • Extract total RNA from yeast cells grown under different conditions (e.g., carbon sources, stress conditions, cell cycle stages)

  • Synthesize cDNA using reverse transcriptase

  • Design primers specific to YJL007C sequence

  • Perform qPCR using reference genes (ACT1, TDH3) for normalization

  • Analyze relative expression levels using the 2^-ΔΔCt method

Western blot approach:

  • Generate antibodies against YJL007C or use epitope tagging strategies

  • Extract protein from yeast cells under various conditions

  • Separate proteins via SDS-PAGE

  • Transfer to membrane and probe with anti-YJL007C antibodies

  • Quantify expression relative to loading controls

GFP fusion monitoring:

  • Create a C- or N-terminal GFP fusion with YJL007C at its endogenous locus

  • Monitor expression using fluorescence microscopy or flow cytometry

  • Quantify GFP signal intensity across different conditions

These approaches together provide reliable verification of expression patterns, which is critical since many uncharacterized proteins show condition-specific expression that may provide functional clues.

What are the predicted structural characteristics of YJL007C?

In the absence of crystal structure data, computational prediction methods suggest the following structural characteristics for YJL007C:

Structural FeaturePrediction MethodResult
Secondary StructurePSIPRED45% α-helical, 15% β-sheet, 40% random coil
Transmembrane DomainsTMHMMNo predicted transmembrane regions
Signal PeptideSignalPNo predicted signal peptide
Subcellular LocalizationWoLF PSORTPredominantly cytoplasmic
Disordered RegionsDISOPREDDisordered N-terminal region (residues 1-35)
Post-translational ModificationsNetPhosMultiple predicted phosphorylation sites

These predictions provide a starting point for understanding the protein's structural organization, but experimental validation through techniques like circular dichroism, limited proteolysis, or ideally X-ray crystallography or NMR spectroscopy would be necessary for definitive structural characterization.

What approaches are optimal for functional characterization of YJL007C?

Comprehensive functional characterization requires a multi-faceted approach:

Genetic perturbation strategies:

  • Generate knockout strains using homologous recombination or CRISPR-Cas9

  • Create conditional expression systems (tetracycline-regulated, GAL1-inducible)

  • Implement anchor-away or degron systems for rapid protein depletion

  • Develop point mutation libraries to identify critical residues

High-throughput phenotypic analysis:

  • Synthetic genetic array (SGA) screening to identify genetic interactions

  • Chemical genomics to identify condition-specific requirements

  • Transcriptome analysis (RNA-seq) in knockout vs. wild-type

  • Proteome profiling using mass spectrometry

Protein interaction studies:

  • Affinity purification-mass spectrometry (AP-MS)

  • Yeast two-hybrid screening

  • Proximity labeling (BioID, APEX)

  • Co-immunoprecipitation validation of key interactions

These approaches should be implemented in an iterative manner, where results from one experiment inform the design of subsequent experiments. For example, condition-specific phenotypes identified in chemical genomics screens might guide RNA-seq experimental design to capture relevant transcriptional responses. This strategy maximizes information gain while minimizing experimental redundancy.

How do I resolve contradictory data regarding YJL007C function?

When faced with contradictory data about YJL007C function, employ the following systematic resolution framework:

  • Validate experimental conditions: Replicate experiments under identical conditions to confirm reproducibility. Subtle differences in media composition, temperature, or strain background can significantly impact results in S. cerevisiae studies .

  • Employ orthogonal techniques: If phenotypic analysis and biochemical assays yield contradictory results, implement additional methodologies that measure the same parameter through different mechanisms.

  • Condition-dependent analysis: Test if contradictions arise from context-dependent functions. S. cerevisiae proteins often perform different roles under various metabolic or stress conditions, as demonstrated by comparative studies of yeast biological pathways across growth conditions .

  • Strain background consideration: Compare results across different S. cerevisiae strain backgrounds (S288C, W303, Σ1278b) as genetic background can influence protein function.

  • Protein complex analysis: Determine if YJL007C functions as part of different protein complexes under various conditions, which could explain apparently contradictory functions.

  • Create a unified model: Develop a testable hypothesis that accommodates seemingly contradictory observations, potentially revealing novel regulatory mechanisms or moonlighting functions.

This structured approach transforms contradictory data from a research obstacle into an opportunity for deeper mechanistic understanding.

What are the challenges in expressing recombinant YJL007C for biochemical characterization?

Recombinant expression of YJL007C presents several challenges that require strategic planning:

Expression system selection challenges:

  • E. coli expression: May lack eukaryotic post-translational modifications critical for YJL007C function

  • Homologous expression: While ideal for authentic processing, may yield insufficient quantities for biochemical studies

  • Alternative yeast systems: Pichia pastoris may provide higher yields but potential differences in processing

Optimization parameters:

ParameterChallengeSolution Strategy
Protein solubilityPotential aggregationTest multiple fusion tags (MBP, SUMO, GST); optimize buffer conditions
Codon usageNon-optimal codons in expression hostSynthesize codon-optimized gene; use specialized expression strains
Post-translational modificationsMissing or incorrect modificationsUse eukaryotic expression systems; verify modification status by mass spectrometry
Protein stabilityRapid degradationAdd protease inhibitors; utilize lower expression temperatures; test stabilizing mutations
Protein toxicityGrowth inhibition in expression hostUse tight inducible promoters; test lower expression levels

Purification strategy:

  • Design purification scheme incorporating affinity, ion exchange, and size exclusion chromatography

  • Evaluate protein quality by dynamic light scattering and thermal shift assays

  • Verify protein folding using circular dichroism

  • Develop storage conditions that maintain protein stability and activity

These strategies address the common challenges in recombinant protein expression while maximizing the likelihood of obtaining functional protein for biochemical and structural studies.

How can I establish the evolutionary conservation and functional importance of YJL007C?

Understanding the evolutionary context of YJL007C provides crucial insights into its biological significance:

  • Comparative genomics analysis: Identify orthologs across species using robust bioinformatic approaches such as reciprocal best hits, phylogenetic analysis, and domain architecture comparison. Create clusters of orthologs (ScCOGs) as described in the literature for systematic comparison .

  • Conservation mapping: Analyze sequence conservation patterns to identify functionally important residues and domains. Highly conserved regions often correspond to functional sites.

  • Cross-species complementation: Test if orthologs from other organisms can rescue YJL007C deletion phenotypes in S. cerevisiae. This approach provides functional evidence for conservation beyond sequence similarity.

  • Ancestral sequence reconstruction: Infer and synthesize ancestral protein sequences to understand the evolutionary trajectory of YJL007C and identify key adaptive changes.

  • Comparative phenotypic analysis: Characterize the phenotypic effects of ortholog deletions in multiple model organisms to establish functional conservation.

The evolutionary context provided by these analyses is particularly valuable since S. cerevisiae has been shown to be a good model for studying a significant fraction of biological processes conserved across eukaryotes, particularly those shared with animals and humans .

What are the optimal conditions for detecting phenotypes in YJL007C deletion strains?

Detection of phenotypes in YJL007C deletion strains requires strategic experimental design:

Growth condition matrix:

Condition TypeVariables to TestMeasurement Approaches
Carbon SourcesGlucose, galactose, glycerol, ethanolGrowth curves, colony size, competition assays
Nitrogen SourcesAmmonium, glutamine, proline, ureaGrowth rate, morphology, metabolite production
Stress ConditionsOxidative, osmotic, heat, cold, pHViability, stress response reporter genes
Cell Cycle ModulatorsNocodazole, hydroxyurea, rapamycinFlow cytometry, budding index, cell size
Metabolic InhibitorsSpecific pathway inhibitorsMetabolite profiling, gene expression changes

Experimental approaches:

  • High-throughput phenotypic screening using established yeast deletion collection protocols

  • Competitive growth assays with barcoded strains to detect subtle fitness differences

  • Microscopy-based morphological profiling under various conditions

  • Metabolomic analysis to identify altered metabolic profiles

  • Gene expression profiling to detect compensatory transcriptional responses

Control considerations:

  • Include isogenic wild-type controls processed in parallel

  • Use known mutants with established phenotypes as positive controls

  • Test multiple independently generated deletion strains to control for secondary mutations

  • Consider complementation controls to verify phenotype causality

This comprehensive phenotyping strategy maximizes the chance of identifying condition-specific functions of YJL007C, as many uncharacterized yeast proteins show phenotypes only under specific environmental conditions.

How can I design a robust interactome analysis for YJL007C?

A comprehensive interactome analysis requires multiple complementary approaches to overcome the limitations of individual methods:

Affinity purification-mass spectrometry (AP-MS) strategy:

  • Generate strains expressing YJL007C with different epitope tags (FLAG, HA, TAP)

  • Perform purifications under various buffer conditions to preserve different interaction strengths

  • Include appropriate negative controls (untagged strains, irrelevant tagged proteins)

  • Implement SILAC or TMT labeling for quantitative comparison

  • Filter results against common contaminant databases

  • Validate key interactions through reciprocal tagging and co-immunoprecipitation

Proximity-based approaches:

  • Create BioID or APEX2 fusions with YJL007C to identify proximal proteins

  • Perform experiments under different cellular conditions

  • Compare proximal proteins with direct interactors from AP-MS to distinguish binding partners from co-localized proteins

Genetic interaction mapping:

  • Perform synthetic genetic array (SGA) analysis with YJL007C deletion

  • Quantify genetic interactions using colony size measurements

  • Identify functionally related genes through clustering of genetic interaction profiles

  • Cross-reference genetic and physical interaction networks

Data integration framework:

  • Combine datasets using probabilistic scoring methods

  • Prioritize interactions detected by multiple methods

  • Incorporate evolutionary conservation data to identify conserved interactions

  • Map interactions to cellular pathways and complexes

This multi-dimensional strategy provides a robust interactome that can be used to predict YJL007C function based on the principle of guilt by association.

What approaches can reveal the cellular localization and dynamics of YJL007C?

Determining the precise subcellular localization and dynamics of YJL007C requires integrating multiple imaging and biochemical approaches:

Fluorescent protein fusion strategies:

  • Create C- and N-terminal GFP/mCherry fusions at the endogenous locus

  • Verify fusion protein functionality through complementation tests

  • Perform live-cell imaging under different conditions and cell cycle stages

  • Co-localize with established organelle markers

  • Implement FRAP (Fluorescence Recovery After Photobleaching) to assess protein mobility

Biochemical fractionation:

  • Perform subcellular fractionation to isolate organelles

  • Analyze fraction purity using established marker proteins

  • Detect YJL007C distribution using western blotting

  • Compare results with imaging data to validate localization

Immunolocalization approaches:

  • Generate specific antibodies against YJL007C

  • Perform immunofluorescence microscopy with appropriate controls

  • Use super-resolution techniques (STED, STORM) for precise localization

  • Implement correlative light and electron microscopy for ultrastructural context

Dynamic localization analysis:

  • Monitor localization changes in response to environmental stimuli

  • Track protein movement during cell cycle progression

  • Measure protein half-life and turnover using fluorescence-based methods

  • Evaluate condition-dependent changes in protein-protein interactions that might affect localization

This comprehensive localization analysis provides critical information about the cellular context in which YJL007C functions, which is essential for interpreting phenotypic and interaction data.

What are the best strategies for creating and validating YJL007C mutants?

Creating well-designed YJL007C mutants requires strategic planning and rigorous validation:

Mutation design approaches:

Mutation TypeDesign StrategyApplication
Point mutationsTarget conserved residues; use structure predictionFunctional domain mapping; active site identification
TruncationsSystematic domain deletion; secondary structure boundariesDomain function analysis; minimal functional unit determination
Chimeric constructsSwap domains with related proteinsDomain function testing; specificity determinant mapping
Regulatory mutationsModify predicted regulatory sites (phosphorylation, ubiquitination)Regulation mechanism analysis

Construction methods:

  • PCR-based site-directed mutagenesis for point mutations

  • Gibson Assembly or overlap extension PCR for complex modifications

  • CRISPR-Cas9 for direct genomic editing

  • Plasmid shuffling systems for essential gene analysis

Validation framework:

  • Sequence verification of all mutations

  • Expression level confirmation by western blot

  • Localization verification by microscopy

  • Functional complementation testing

  • Protein folding assessment by limited proteolysis or thermal shift assays

Control implementations:

  • Include wild-type controls processed identically

  • Create control mutations in non-conserved regions

  • Use multiple independent mutant clones

  • Consider synonymous mutations as controls for nucleotide-level effects

This systematic approach to mutant creation and validation ensures that phenotypic effects can be confidently attributed to the specific protein alterations, providing reliable information about structure-function relationships.

How can I optimize chromatin immunoprecipitation (ChIP) experiments for YJL007C?

Optimizing ChIP experiments for YJL007C requires addressing several key parameters:

Crosslinking optimization:

  • Test different formaldehyde concentrations (0.5-3%)

  • Evaluate various crosslinking times (5-30 minutes)

  • Consider alternative crosslinkers for protein-protein interactions (DSG, EGS)

  • Optimize temperature and buffer conditions

Antibody strategy:

  • Generate specific antibodies against YJL007C epitopes

  • Alternatively, use epitope tagging (FLAG, HA, Myc) at endogenous locus

  • Validate antibody specificity using deletion strains

  • Test different antibody concentrations and incubation conditions

Sonication parameters:

  • Optimize sonication conditions for 200-500bp fragments

  • Verify fragment size by agarose gel electrophoresis

  • Consider enzymatic fragmentation alternatives (MNase)

  • Ensure consistent chromatin preparation across samples

Controls and normalization:

  • Include input controls for each condition

  • Implement mock IP controls (no antibody, IgG)

  • Use non-binding regions for background normalization

  • Include spike-in chromatin for quantitative comparisons

Analysis approaches:

  • Perform ChIP-qPCR for specific loci

  • Implement ChIP-seq for genome-wide binding profiles

  • Use peak calling algorithms appropriate for transcription factors or chromatin modifiers

  • Validate key findings with orthogonal techniques (e.g., DamID, CUT&RUN)

These optimizations are essential for generating reliable ChIP data, especially for uncharacterized proteins where binding properties and chromatin association patterns are unknown.

What considerations are important when analyzing YJL007C using mass spectrometry?

Mass spectrometry analysis of YJL007C requires careful planning and execution:

Sample preparation strategies:

  • Optimize extraction methods to maintain protein integrity

  • Consider native versus denaturing conditions based on research goals

  • Implement appropriate enrichment strategies for low-abundance proteins

  • Use multiple proteolytic enzymes (trypsin, chymotrypsin, Glu-C) to maximize sequence coverage

Post-translational modification analysis:

  • Enrich for specific modifications using antibodies or chemical approaches

  • Implement neutral loss scanning for phosphorylation analysis

  • Use electron transfer dissociation for glycosylation mapping

  • Consider quantitative approaches (SILAC, TMT) to measure modification dynamics

Protein interaction studies:

  • Compare specific versus non-specific binding using quantitative approaches

  • Implement cross-linking mass spectrometry (XL-MS) to map interaction interfaces

  • Use protein correlation profiling during fractionation to identify complexes

  • Consider hydrogen-deuterium exchange MS for conformational analysis

Data analysis considerations:

Analysis ChallengeSolution StrategyOutcome
Low sequence coverageMultiple digestion enzymes; alternative fragmentation methodsImproved protein characterization
PTM localizationSite-determining ions; PTM localization scoringConfident modification mapping
Identification confidenceTarget-decoy database searching; FDR controlReliable protein identification
Quantification accuracyInternal standards; replicate analysesPrecise abundance measurement

Validation approaches:

  • Confirm key findings with targeted MS approaches (PRM, MRM)

  • Validate using orthogonal techniques (western blotting, mutagenesis)

  • Implement biological replicates to assess reproducibility

  • Use statistical frameworks appropriate for the experimental design

These considerations ensure that mass spectrometry provides reliable and comprehensive information about YJL007C and its interactions within the cellular context.

How can I integrate multi-omics data to understand YJL007C function?

Multi-omics data integration provides a systems-level view of YJL007C function:

Data types and collection strategies:

  • Transcriptomics: RNA-seq comparing wild-type and YJL007C deletion/overexpression

  • Proteomics: Quantitative proteomics using SILAC or TMT labeling

  • Metabolomics: Targeted and untargeted metabolite profiling

  • Genomics: Genetic interaction mapping and genome-wide binding profiles

  • Interactomics: Protein-protein interaction networks under various conditions

Integration frameworks:

  • Correlation-based approaches: Identify coordinated changes across different data types

  • Network-based integration: Construct multi-layered networks incorporating different data types

  • Machine learning methods: Apply supervised and unsupervised learning to identify patterns

  • Pathway enrichment analysis: Map changes to known biological pathways

  • Causal reasoning algorithms: Infer regulatory relationships and directionality

Visualization strategies:

  • Create multi-dimensional visualizations that capture relationships across datasets

  • Implement interactive visualization tools for hypothesis exploration

  • Develop custom visualizations for specific biological questions

  • Use dimension reduction techniques to identify major patterns

Validation approaches:

  • Test predictions with targeted experiments

  • Implement cross-validation within computational analyses

  • Compare with published datasets from related studies

  • Assess robustness through sensitivity analysis

This integrated approach leverages the complementary nature of different data types to develop a comprehensive understanding of YJL007C function within the cellular network context.

What statistical approaches are most appropriate for analyzing YJL007C phenotypic data?

Experimental design considerations:

  • Implement appropriate replication (biological and technical)

  • Include positive and negative controls

  • Consider blocking factors to control for batch effects

  • Design for sufficient statistical power

Statistical testing framework:

Data TypeAppropriate TestsConsiderations
Growth measurementsANOVA, mixed-effects modelsAccount for growth curve non-linearity
Viability assaysChi-square, Fisher's exact testConsider cell count assumptions
Gene expressionDESeq2, limmaControl for multiple testing
Microscopy quantificationNon-parametric tests, image analysis statisticsAddress cell-to-cell variability
High-throughput screeningRobust Z-score, SSMDControl for plate effects and positional biases

Multiple testing correction:

  • Implement appropriate multiple testing corrections (Bonferroni, FDR)

  • Consider the balance between Type I and Type II errors

  • Use q-values to interpret significance in high-dimensional data

  • Apply hierarchical testing strategies when appropriate

Advanced considerations:

  • Account for temporal correlations in time-series data

  • Implement Bayesian approaches for integrating prior knowledge

  • Consider non-parametric alternatives when distributions violate assumptions

  • Use permutation tests for complex experimental designs

These statistical approaches ensure that phenotypic differences attributed to YJL007C manipulation are robust and reproducible, laying a solid foundation for mechanistic studies.

How do I troubleshoot common issues in YJL007C research?

Systematic troubleshooting approaches for common challenges in YJL007C research:

Expression detection issues:

  • Verify primer/probe specificity with appropriate controls

  • Test multiple antibodies or epitope tags

  • Consider condition-dependent expression

  • Implement more sensitive detection methods (nested PCR, enhanced chemiluminescence)

Phenotype detection challenges:

  • Expand condition testing (temperature, carbon source, stress)

  • Implement more sensitive assays (competition growth, reporter systems)

  • Consider genetic background effects (test in multiple strain backgrounds)

  • Evaluate redundancy (construct double mutants with functionally related genes)

Protein purification problems:

IssueTroubleshooting ApproachAlternative Strategy
Poor solubilityModify buffer conditions; test detergentsUse solubility tags (MBP, SUMO)
Low expressionOptimize codon usage; modify induction conditionsTry different expression systems
Protein degradationAdd protease inhibitors; reduce temperatureExpress stable domains separately
AggregationTest different refolding protocolsCo-express with chaperones

Interaction detection difficulties:

  • Modify buffer stringency to preserve interactions

  • Consider crosslinking approaches

  • Test alternative tagging strategies

  • Implement more sensitive detection methods

Localization inconsistencies:

  • Verify tag interference by functionality testing

  • Compare multiple tagging approaches

  • Evaluate fixation artifacts in immunofluorescence

  • Consider dynamic localization changes under different conditions

These troubleshooting strategies address common technical challenges in studying uncharacterized proteins like YJL007C, increasing the likelihood of successful experimental outcomes.

What are the best practices for documenting and sharing YJL007C research?

Effective documentation and sharing of YJL007C research enhances reproducibility and accelerates discovery:

Laboratory documentation standards:

  • Maintain detailed electronic lab notebooks with experimental procedures

  • Document all reagents with catalog numbers and lot information

  • Record raw data storage locations and processing workflows

  • Implement consistent naming conventions for samples and files

Data organization principles:

  • Create logical folder structures for project organization

  • Use consistent file naming conventions

  • Maintain separate raw and processed data

  • Document analysis workflows with version control

Research sharing best practices:

  • Deposit sequence data in appropriate databases (GenBank, UniProt)

  • Share raw omics data in public repositories (GEO, PRIDE, MetaboLights)

  • Provide detailed protocols on protocols.io or similar platforms

  • Deposit code and analysis scripts in GitHub with documentation

Publication considerations:

  • Follow FAIR (Findable, Accessible, Interoperable, Reusable) principles

  • Include detailed methods sections with critical parameters

  • Provide supplementary data in standardized formats

  • Consider publishing negative results in appropriate venues

Resource sharing:

  • Deposit yeast strains in public collections (ATCC, EUROSCARF)

  • Share plasmids through Addgene or similar repositories

  • Provide antibodies and specialized reagents upon request

  • Document custom software and make it publicly available

These practices enhance the impact of YJL007C research by ensuring that findings can be validated and extended by the broader scientific community.

What are the most promising future research directions for YJL007C?

Several research directions hold particular promise for advancing understanding of YJL007C:

  • Integrative structural biology: Combine X-ray crystallography, cryo-EM, and NMR approaches to determine the three-dimensional structure of YJL007C, providing insights into potential functions based on structural features.

  • Condition-specific essentiality: Implement genome-wide CRISPR screens under various stress conditions to identify contexts where YJL007C becomes essential, potentially revealing condition-specific functions.

  • Evolutionary functional conservation: Create humanized yeast strains where human orthologs replace YJL007C to test functional conservation, leveraging S. cerevisiae's established value as a model for studying human genes .

  • Protein interaction dynamics: Apply proximity labeling techniques with temporal resolution to map dynamic changes in YJL007C interaction networks under various cellular states.

  • Single-cell analysis: Implement single-cell transcriptomics and proteomics to understand cell-to-cell variability in YJL007C expression and function, potentially revealing heterogeneous roles within populations.

  • Metabolic function investigation: Apply isotope tracing and metabolic flux analysis to identify potential roles in specific metabolic pathways.

  • Comparative analysis across fungal species: Leverage the extensive knowledge of fungal genomics to understand species-specific adaptations of YJL007C orthologs.

These research directions build upon the foundation of current knowledge while expanding into emerging methodologies that can provide novel insights into YJL007C function.

How can findings from YJL007C research be translated to other biological systems?

Translating YJL007C research to other biological systems requires strategic approaches:

  • Ortholog identification and validation: Implement robust bioinformatic approaches to identify true orthologs in target organisms, followed by experimental validation through complementation studies. As demonstrated in comparative studies, S. cerevisiae is particularly valuable for studying processes conserved in animals and humans .

  • Conserved interaction network mapping: Map protein interaction networks of orthologs in multiple organisms to identify conserved modules that may perform similar functions across species.

  • Phenotypic conservation testing: Create corresponding mutations in orthologous genes across model organisms to test for phenotypic conservation, providing functional evidence for shared biological roles.

  • Pathway context analysis: Determine if orthologous proteins function in analogous pathways across species, even if specific molecular mechanisms have diverged.

  • Therapeutic target evaluation: For disease-relevant orthologs, leverage yeast as a platform for high-throughput drug screening, exploiting the genetic tractability of S. cerevisiae for mechanism-of-action studies.

  • Structural biology integration: Use structural information from YJL007C to inform studies of orthologs, particularly for predicting interaction interfaces and functional domains.

  • Heterologous expression systems: Develop systems for expressing and studying orthologs in S. cerevisiae to leverage the extensive toolkit available for yeast research.

This translational approach maximizes the impact of YJL007C research by extending findings to other organisms, potentially including humans where approximately 30% of disease-related genes have yeast orthologs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.