Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJL067W (YJL067W)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Systems

Recombinant YJL067W is expressed in heterologous hosts, purified to ≥85% purity via SDS-PAGE, and sold for research use . Key production parameters include:

ParameterDetails
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells, Cell-Free Expression
TagsN- or C-terminal His-tag (varies by vendor)
Purity AssuranceValidated by SDS-PAGE and mass spectrometry
StorageLyophilized or liquid, stable at -20°C to -80°C

Optimized protocols for yeast-based expression emphasize galactose induction and affinity chromatography .

Functional Insights and Biological Context

While YJL067W remains uncharacterized, studies on its paralog YER067W suggest potential roles in:

  • Stress Response: Co-regulated with genes involved in energy metabolism under stress (e.g., heat, osmotic pressure) .

  • Carbohydrate Metabolism: Deletion mutants of paralogs show altered glycogen and trehalose accumulation .

  • Drug Resistance: YER067W knockout enhances tolerance to antifungals (e.g., fluconazole) , hinting at conserved roles in detoxification pathways.

Research Applications

Recombinant YJL067W is utilized in:

  • Antibody Production: Rabbit polyclonal antibodies target epitopes for ELISA and Western blot .

  • Protein Interaction Studies: Yeast two-hybrid screens to identify binding partners .

  • Structural Biology: Commercial availability supports crystallization and NMR studies .

Comparative Analysis with Paralogs

A comparison of YJL067W and its paralog YER067W highlights shared and distinct features:

FeatureYJL067WYER067W
Gene RegulationNot well-documentedStress-inducible (e.g., iron depletion)
Knockout PhenotypeUnreportedAltered carbohydrate storage
Drug Resistance RoleIndirect evidence via paralogsConfirmed antifungal tolerance

Future Directions

Critical research gaps include:

  • Functional Characterization: Elucidating enzymatic or regulatory roles via knockout studies.

  • Subcellular Localization: Confirming membrane association through fluorescence tagging.

  • Clinical Relevance: Assessing implications in fungal pathogenesis or industrial biotechnology.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you require a specific format, please indicate your preference when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YJL067W; HRA116; J1107; Putative uncharacterized protein YJL067W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJL067W
Target Protein Sequence
MSKKRKRKYVLIVFVNTHHFMLHLGTGTLGGSGGSNVYRAIVKVDFFSFDGAGFCIIGIL RGTNGLCPSNNFLGSICRSIFSIVAQMQVVPIQHEVFWSSSQRLYGSAPSLDSLFL
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the putative uncharacterized protein YJL067W in S. cerevisiae?

YJL067W is an open reading frame (ORF) in Saccharomyces cerevisiae that encodes a putative uncharacterized protein. As suggested by its designation, its precise function has not been well-characterized in the scientific literature. The gene is located on chromosome X of S. cerevisiae. Initial investigations typically begin with sequence analysis, comparative genomics, and expression profiling to generate hypotheses about potential functions.

Why is S. cerevisiae an appropriate model organism for studying uncharacterized proteins like YJL067W?

S. cerevisiae (baker's yeast) serves as an excellent model organism for studying uncharacterized proteins for several reasons:

  • It is one of the most intensively studied eukaryotic model organisms in molecular and cell biology

  • Its genome is fully sequenced and well-annotated

  • Many proteins important in human biology were first discovered by studying their homologs in yeast

  • It reproduces rapidly and is easily maintained in laboratory conditions

  • Well-established genetic manipulation protocols exist for this organism

  • Extensive genetic interaction data is available for predicting functions of uncharacterized proteins

  • It has contributed to the identification of more mammalian genes affecting aging than any other model organism

These characteristics make S. cerevisiae an ideal system for investigating proteins of unknown function through various genomic, proteomic, and functional approaches.

What initial approaches should researchers take when beginning to study YJL067W?

When initiating research on YJL067W, researchers should consider:

  • Bioinformatic analysis to identify potential structural motifs, homologs in other species, and predicted functions

  • Gene deletion using techniques like the short flanking homology (SFH) method with selection markers such as KanMX4

  • Phenotypic characterization of deletion mutants under various growth conditions

  • Expression analysis to determine when and where the protein is expressed

  • Protein localization studies using fluorescent tags

  • Integration of existing genetic interaction data to predict functional relationships

  • Comparative analysis with similar uncharacterized proteins within the Saccharomyces genus

How can researchers effectively create deletion mutants of YJL067W for functional studies?

Creating precise deletion mutants is a fundamental approach for studying YJL067W function:

  • Design primers containing 40-60 base pairs of homology to YJL067W flanking regions

  • Amplify a deletion cassette containing a selectable marker (e.g., KanMX4 conferring resistance to geneticin) from a plasmid like pUG6

  • Transform S. cerevisiae using the lithium acetate method

  • Select transformants on appropriate selective media (e.g., YPD with 200 mg/L G418 disulphate salt)

  • Confirm successful deletion by PCR verification

  • Create multiple independent deletion strains to ensure phenotypes are not due to secondary mutations

  • Generate complementation strains by reintroducing YJL067W to verify phenotype rescue

What growth conditions and media formulations should be considered when phenotyping YJL067W mutants?

To comprehensively characterize YJL067W deletion phenotypes, researchers should test various growth conditions:

  • Standard rich media (YPD: 20 g/L glucose, 20 g/L peptone, 10 g/L yeast extract)

  • Defined minimal media (SD: 2% glucose, 0.017% yeast nitrogen base) with controlled nitrogen sources (e.g., 230.8 mg/L NH₄Cl providing 60 mg/L YAN)

  • Synthetic grape must for fermentation studies (100 g/L glucose, 100 g/L fructose with varied nitrogen content)

  • Media with different carbon sources to test metabolic dependencies

  • Stress conditions (oxidative, osmotic, temperature, pH variations)

  • Nutrient limitation conditions, particularly nitrogen restrictions

  • DNA-damaging agent exposure if DNA repair functions are suspected

How can continuous culture techniques be optimized for studying YJL067W function?

Chemostat cultures provide precise control for physiological characterization:

  • Establish cultures in a bioreactor (e.g., 0.5 L reactor with 0.35 L working volume)

  • Maintain controlled conditions: temperature 28°C, pH 3.3, stirring at 300 rpm

  • Set dilution rate at 0.2 h⁻¹, corresponding to exponential growth phase

  • Begin with batch culture using the same conditions as planned for continuous culture

  • Transition to continuous mode when the batch culture reaches stationary phase

  • Sample steady states after at least five residence times when biomass values stabilize

  • Systematically vary media composition to identify condition-dependent functions

How can synthetic genetic array (SGA) approaches be used to position YJL067W in cellular networks?

SGA analysis can reveal genetic interactions and pathway connections:

  • Cross a YJL067W deletion strain (marked with a selectable marker) with arrays of deletion mutants

  • Select double mutants using appropriate selective markers

  • Quantify growth rates to identify synthetic lethal or synthetic sick interactions

  • Group genes with similar genetic interaction profiles to YJL067W

  • Use the global network of gene interactions organized by function to predict YJL067W's role

  • Focus on genes with similar genetic interaction profiles as they tend to be part of the same pathway or biological process

  • Validate key interactions with targeted experiments

This approach leverages the comprehensive model containing genetic interaction profiles for approximately 75% of all genes in budding yeast .

What methods are most effective for tagging and tracking YJL067W protein in live cells?

To study YJL067W's expression, localization, and dynamics:

  • C-terminal or N-terminal tagging with fluorescent proteins (GFP, mCherry) using PCR-based integration

  • Epitope tagging (HA, Myc, FLAG) for immunodetection if fluorescent tags affect function

  • Time-lapse microscopy to track protein dynamics during cell cycle progression

  • Inducible promoter systems to control expression levels

  • Split fluorescent protein systems to study protein-protein interactions in vivo

  • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility

  • Anchor-away techniques to study the effects of conditional protein depletion from specific compartments

How can researchers effectively study potential roles of YJL067W in meiosis and recombination?

If YJL067W is suspected to function in meiosis or recombination processes:

  • Induce sporulation in diploid strains with YJL067W deletions and assess sporulation efficiency

  • Measure meiotic recombination rates using genetic markers

  • Examine sensitivity to DNA-damaging agents, as genes required for meiotic recombination often show increased sensitivity

  • Test for synthetic interactions with known meiotic recombination genes (e.g., RAD52)

  • Analyze DNA repair capacity in vegetative cells, as many meiotic proteins also function in mitotic repair

  • Examine chromosome segregation during meiosis using fluorescent markers

  • Assess spore viability and genetic composition to detect potential recombination defects

How should researchers approach contradictory results when characterizing YJL067W?

When facing contradictory findings:

  • Verify strain backgrounds to ensure they are truly isogenic except for the targeted modification

  • Test multiple independently generated deletion strains to rule out secondary mutations

  • Perform complementation tests by reintroducing YJL067W to confirm phenotype reversal

  • Consider condition-dependent effects that might explain different experimental outcomes

  • Examine potential genetic interactions that might mask or enhance phenotypes in different strain backgrounds

  • Assess the sensitivity and specificity of different assays used

  • Design epistasis experiments with known pathway components to resolve apparent contradictions

What bioinformatic strategies are most valuable for predicting YJL067W function?

Computational approaches to guide functional hypotheses include:

  • Sequence-based analyses:

    • Homology searches across species

    • Protein domain and motif identification

    • Structural prediction using tools like AlphaFold

  • Network-based analyses:

    • Integration with genetic interaction networks

    • Co-expression patterns across diverse conditions

    • Protein-protein interaction predictions

  • Evolutionary approaches:

    • Phylogenetic profiling across yeast species

    • Analysis of selection pressure on sequence conservation

    • Synteny conservation in related yeasts

  • Functional prediction:

    • Gene Ontology term enrichment of interacting partners

    • Pathway enrichment analysis

    • Text mining of scientific literature

How might researchers investigate potential roles of YJL067W in aging processes?

Given S. cerevisiae's value in aging research , potential approaches include:

  • Measure Replicative Life Span (RLS) in YJL067W deletion strains (number of times a cell divides)

  • Assess Chronological Life Span (CLS) to determine survival in non-dividing state

  • Test effects of calorie restriction, which increases RLS and CLS in yeast

  • Examine interactions with known aging pathways like TOR signaling

  • Investigate potential roles in preventing the accumulation of extrachromosomal rDNA circles, a cause of senescence in yeast

  • Test overexpression effects on lifespan

  • Perform epistasis analysis with established aging genes (e.g., SIR2, FOB1)

What approaches are recommended for investigating potential cell cycle roles of YJL067W?

To explore possible cell cycle functions:

  • Analyze cell morphology and division patterns in deletion strains

  • Synchronize cells and examine progression through cell cycle phases

  • Investigate potential roles in asymmetric cell division, which is significant in S. cerevisiae

  • Examine genetic interactions with known cell cycle regulators

  • Monitor spindle formation and chromosome segregation

  • Assess potential roles in cytokinesis and bud formation

  • Investigate timing of expression during the cell cycle

How can researchers assess potential roles of YJL067W in DNA damage response pathways?

If DNA repair functions are suspected:

  • Test sensitivity to various DNA-damaging agents (UV, MMS, hydroxyurea)

  • Examine genetic interactions with known DNA repair genes

  • Monitor recombination rates in mitotic and meiotic cells

  • Assess chromosome stability and mutation rates in deletion strains

  • Examine localization of the protein after DNA damage induction

  • Test for synthetic interactions with genes in specific repair pathways

  • Measure expression changes in response to genotoxic stress

Standard Growth Media for YJL067W Functional Studies

Media TypeCompositionApplicationSelection
YPD20 g/L glucose, 20 g/L peptone, 10 g/L yeast extract General growthNon-selective
SD2% glucose, 0.017% yeast nitrogen base, 230.8 mg/L NH₄Cl Defined mediumNitrogen-controlled (60 mg/L YAN)
YPD-G418YPD + 200 mg/L G418 disulphate salt SelectionKanMX4-marked strains
Synthetic Must100 g/L glucose, 100 g/L fructose, varied nitrogen Fermentation studiesMimics grape must conditions
Sporulation1% potassium acetate, amino acidsMeiosis inductionDiploid cells

Recommended Primers for YJL067W Manipulation

ApplicationForward Primer DesignReverse Primer DesignTemplateNotes
Deletion40-60bp YJL067W upstream homology + KanMX4 sequence40-60bp YJL067W downstream homology + KanMX4 sequencepUG6 plasmid For SFH method
VerificationBinds ~200bp upstream of YJL067WBinds within KanMX4Genomic DNAConfirms 5' integration
C-term Tagging40bp upstream of stop codon + tag sequence40bp downstream of stop codon + tag sequenceTag plasmidPreserves regulatory elements
ExpressionIncludes restriction sites + start codonIncludes restriction sites + stop codonGenomic DNAFor plasmid-based expression

Phenotypic Analysis Parameters for Growth Experiments

ParameterMeasurement MethodAnalysis ApproachSignificance Threshold
Growth RateOD600 readings every 30 min Fit to Gompertz equation p < 0.05 vs. wild type
Lag PhaseTime to exit lag phaseDirect measurement from growth curve>20% difference from control
Max ODStationary phase OD600Direct measurementp < 0.05 vs. wild type
Stress ToleranceSurvival ratio after stressCFU counting on plates>1 log difference
Competitive FitnessPopulation ratios over timeReplica plating from YPD to YPD-G418 >10% population shift

What emerging technologies might accelerate characterization of YJL067W?

Novel approaches that could advance understanding of YJL067W include:

  • CRISPR-Cas9 base editing for precise point mutations without selection markers

  • RNA-seq and ribosome profiling to understand transcriptional and translational impacts

  • Proximity labeling approaches (BioID, APEX) to identify protein interaction neighborhoods

  • Single-cell technologies to detect cell-to-cell variability in expression and response

  • High-throughput phenotyping with automated image analysis

  • Cryo-EM for structural studies if the protein forms complexes

  • Metabolomics to identify metabolic pathways affected by YJL067W perturbation

How should collaborative research on YJL067W be structured for maximum efficiency?

Effective collaborative research frameworks include:

  • Division of experimental approaches among teams with complementary expertise

  • Standardization of strains, growth conditions, and phenotyping methods

  • Centralized data repository for sharing raw data and analyses

  • Regular communication of preliminary findings to adjust research directions

  • Integration of computational and experimental approaches

  • Multilevel analysis (genomic, transcriptomic, proteomic, phenotypic)

  • Coordinated publication strategy to ensure comprehensive characterization

What potential biotechnological applications might emerge from YJL067W characterization?

Depending on its function, YJL067W characterization could lead to:

  • Development of new selectable markers for yeast genetic engineering

  • Identification of novel stress response mechanisms applicable to industrial fermentation

  • Discovery of new regulatory mechanisms for synthetic biology applications

  • Potential targets for antifungal development if conserved in pathogenic fungi

  • Enhanced understanding of fundamental eukaryotic processes with broader implications

  • Optimized yeast strains for biotechnological applications

  • Novel tools for controlling gene expression or protein function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.