Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJL086C (YJL086C)

Shipped with Ice Packs
In Stock

Description

General Information

YJL086C is a putative uncharacterized protein in Saccharomyces cerevisiae, also known as Baker's yeast . The term "putative" indicates that the protein's function has not been experimentally determined, but it is predicted based on computational analyses or sequence homology to other proteins .

Basic Characteristics

CharacteristicDescription
OrganismSaccharomyces cerevisiae (strain ATCC 204508 / S288c)
Protein TypeRecombinant protein
Alternative NameYMR086C-A
UniProt IDQ6Q571
Purity>85% (SDS-PAGE)
SourceMammalian cell
Protein LengthFull length protein (1-112)
SequenceMLLFCYCLLL GTRIGTRIGT RIFIVHPIIS PLIAVETAKK KKHIKWRFLD YSLLKNPLYV TVHGSHRSEV ERARKRIKYI TCTRREFLPR VPISFYQRFF SVFCRNYPSF LL

Role of Saccharomyces cerevisiae

Saccharomyces cerevisiae is a well-studied eukaryotic organism used as a model in biological research . It has an extensive history of safe use, with limited reports of pathogenicity in humans or animals, and only in cases where the human host had a debilitating condition . S. cerevisiae serves as a valuable tool for basic research on eukaryotic organisms .

Protein Complex Catalogues

Two catalogues of yeast protein complexes, CYC2008 and YHTP2008, offer insight into protein-protein interactions within S. cerevisiae . The CYC2008 catalogue is a comprehensive collection of 408 manually curated heteromeric protein complexes, backed by small-scale experiments . The YHTP2008 catalogue consists of 400 high-throughput complexes, with 262 corresponding, at least partially, to CYC2008 complexes .

Virulence Factors

S. cerevisiae has low phospholipase activity, a key virulence factor associated with yeasts, making it a nonpathogenic yeast . It doesn't carry virulence factors to humans or animals, although it carries linear, double-stranded plasmids that can be transmitted to other Saccharomyces .

Orthologs and Homologues

Clusters of orthologs (ScCOGs) and homologues (ScCHGs) have been created for each S. cerevisiae protein with respect to the translated genome of other organisms . These clusters are associated with functional terms corresponding to their biological role .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YJL086C; J0930; Putative uncharacterized protein YJL086C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJL086C
Target Protein Sequence
MSISAGISINAFDIIKPEHFNGPLLFTASTLRVHSPWFSNTFKHTVSVNYLYVPAGRPRT FPLIKFHYEFIPKKVYRRASNSFHSVENCFEQILRICIVFLSLKIYTLTLVIIKVFIRRS DA
Uniprot No.

Target Background

Database Links

STRING: 4932.YJL086C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Saccharomyces cerevisiae and why is it a valuable model organism?

Saccharomyces cerevisiae, commonly known as baker's yeast or brewer's yeast, has been utilized for centuries in bread leavening and alcoholic beverage fermentation. Beyond its industrial applications, it has become an invaluable model organism in molecular biology and genetics research for several reasons:

S. cerevisiae is a eukaryotic organism with cellular processes that often parallel those in higher organisms, making it relevant for understanding human cellular mechanisms. Its genome is fully sequenced and relatively compact compared to other eukaryotes, enabling easier genetic manipulation. Additionally, S. cerevisiae has a short generation time and can be maintained in both haploid and diploid states, facilitating genetic studies.

The organism is generally regarded as safe, with minimal pathogenic potential. Studies have demonstrated that even when large quantities are ingested, pathogenicity is rare and typically only occurs in immunocompromised individuals. In hospital surveys, S. cerevisiae accounts for less than 1% of all yeast infections, and many isolates are considered contaminants rather than causative agents of disease .

What are putative uncharacterized proteins and why are they worth studying?

Putative uncharacterized proteins are gene products that have been identified through genomic sequencing but whose functions remain unknown or incompletely understood. These proteins are typically identified through homology or computational prediction methods but lack experimental validation of their biological roles.

Studying these proteins is crucial for several reasons:

  • They may represent novel biological functions or pathways

  • They could be essential for cellular processes under specific conditions

  • They may serve as potential targets for biotechnological applications

  • Understanding their functions completes our knowledge of cellular systems

YJL086C is one such putative uncharacterized protein in S. cerevisiae that has been identified in genomic screens but whose precise function requires further investigation .

What experimental approaches are commonly used to initially characterize uncharacterized proteins in yeast?

Initial characterization of uncharacterized proteins typically follows a structured approach:

  • Sequence analysis and homology searching: Comparing the protein sequence with characterized proteins across species can provide initial functional hints.

  • Expression profiling: Determining when and where the protein is expressed using techniques such as RT-PCR or RNA-seq.

  • Gene deletion studies: Creating knockout strains to observe phenotypic changes.

  • Multicopy suppression screening: This approach, particularly useful for initial characterization, involves overexpressing the gene of interest to determine if it can rescue (suppress) a known phenotypic defect in another mutant strain .

  • Protein localization: Using GFP-tagging or immunofluorescence to determine where the protein localizes within the cell.

  • Protein-protein interaction studies: Techniques such as yeast two-hybrid or co-immunoprecipitation to identify interaction partners.

For YJL086C specifically, initial studies have included it in multicopy suppression screenings, where it was cloned with specific restriction enzymes (EcoRI/XbaI) into plasmid vectors for functional analysis .

How should I design experiments to characterize the function of YJL086C?

Designing experiments to characterize YJL086C requires a systematic approach that builds upon established methodologies in yeast genetics and molecular biology:

  • Define clear research questions: Start with specific hypotheses about the protein's function based on preliminary data or computational predictions.

  • Identify variables: Define your independent variable (what you'll manipulate) and dependent variable (what you'll measure) clearly.

    Research Question ExampleIndependent VariableDependent Variable
    Role of YJL086C in cold stress responseYJL086C expression levelsGrowth rate at low temperature
    YJL086C involvement in nitrogen metabolismNitrogen source/concentrationYJL086C expression levels
  • Plan appropriate controls: Always include both positive and negative controls, as well as wild-type strains for comparison .

  • Consider experimental groups: Decide whether to use a between-subjects design (different strains for each condition) or within-subjects design (same strain under different conditions) .

  • Account for extraneous variables: Control for factors that might influence your results, such as media composition, temperature fluctuations, or batch effects .

  • Determine sample size: Ensure sufficient replication to allow for statistical analysis.

  • Prepare for phenotypic analysis: Be ready to measure growth rates, metabolic activities, stress responses, or other relevant phenotypes .

What are the best methods for genetic manipulation of YJL086C in S. cerevisiae?

Several well-established methods are available for genetic manipulation of YJL086C in S. cerevisiae:

  • Gene deletion/knockout: The short flanking homology (SFH) method is commonly used to replace the open reading frame with a selectable marker such as KanMX4, which confers resistance to geneticin (G418) . This allows for the study of loss-of-function phenotypes.

  • Overexpression studies: Cloning the YJL086C gene, including its own promoter and terminator, into multicopy plasmids such as YEplac195 (URA3) using appropriate restriction enzymes (EcoRI/XbaI for YJL086C) . This approach is particularly useful for multicopy suppression screening.

  • Promoter replacement: Swapping the native promoter with regulatable promoters (e.g., GAL1) to control expression levels.

  • Gene tagging: Adding epitope tags or fluorescent protein tags for protein localization and interaction studies.

  • Site-directed mutagenesis: Creating specific mutations to assess the importance of particular amino acid residues.

The transformation process typically utilizes the lithium acetate method, with transformants selected based on appropriate markers and confirmed by PCR verification .

How can I optimize media conditions for studying YJL086C-related phenotypes?

Media optimization is crucial for revealing phenotypes associated with YJL086C. Based on established methodologies:

  • Standard cultivation media:

    • Begin with Yeast Extract Peptone Dextrose (YPD) medium for initial propagation: 20 g/L glucose, 20 g/L peptone, and 10 g/L yeast extract .

    • For selective growth, use YPD with 200 mg/L G418 disulphate salt for strains containing geneticin resistance markers .

  • Defined media for controlled experiments:

    • Synthetic Defined (SD) media with 2% glucose and 0.017% yeast nitrogen base, supplemented with specific nitrogen sources like NH₄Cl (230.8 mg/L corresponds to 60 mg/L YAN) .

    • Synthetic Grape Must (SM) for fermentation studies, containing defined amounts of glucose, fructose, and other nutrients .

  • Stress condition optimization:

    • For cold stress studies (relevant to YJL086C research), growth at 12°C has been used successfully .

    • Vary carbon sources (e.g., glucose, maltose) to test metabolic flexibility .

  • Nutrient limitation studies:

    • Control nitrogen concentration to examine its effects on protein expression and function.

    • Use chemostat cultures to maintain constant growth conditions: temperature 28°C, pH 3.3, and 300 rpm stirring with a dilution rate of 0.2 h⁻¹ .

What proteomic approaches are most effective for studying YJL086C expression and interactions?

Comprehensive proteomic analysis of YJL086C requires multiple complementary techniques:

  • Protein extraction protocol:

    • Harvest cells (approximately 600 units) by centrifugation at 1,090 × g

    • Resuspend in lysis buffer (50 mM Tris-HCl, 150 mM NaCl, 5 mM EDTA; pH 7.5) with protease inhibitor cocktail

    • Disrupt cells using glass beads (acid-washed, 0.4 mm) with alternating vortexing and ice incubation

    • Remove cell debris by centrifugation at 500 × g for 5 minutes

    • Process supernatant for further analysis

  • Western blotting for expression analysis:

    • Separate proteins by SDS-PAGE and transfer to nitrocellulose membranes

    • Block membranes with 5% milk in TBST (10 mM Tris-HCl [pH 8.0], 150 mM NaCl, 0.1% Tween 20)

    • Probe with appropriate antibodies for detection

  • Mass spectrometry-based approaches:

    • Quantitative proteomics to compare protein abundance across different conditions

    • Examine protein post-translational modifications

    • Identify protein interaction partners through affinity purification coupled with mass spectrometry

  • Cell envelope proteome analysis:

    • Fractionate cells to isolate membrane-associated proteins

    • Compare protein abundance in cell envelope versus cytosolic fractions to determine localization

How can I design competition assays to study the impact of YJL086C on cellular fitness?

Competition assays are powerful tools to quantify subtle fitness effects of YJL086C manipulation:

  • Experimental design for competition assays:

    • Create pairs of strains where one contains a genetic marker (e.g., KanMX4 conferring G418 resistance)

    • Inoculate mixed cultures with equal proportions (50%) of each strain at a defined cell density (2×10⁶ cells/mL)

    • Monitor population dynamics throughout growth or fermentation

  • Sampling and quantification protocol:

    • Determine total population by plating on YPD media and counting colony-forming units (CFU)

    • Determine the percentage of each strain by replica plating from YPD to YPD-G418

    • Calculate relative fitness based on changes in population ratios over time

  • Data analysis and interpretation:

    • Plot population dynamics over time

    • Calculate selection coefficients to quantify fitness differences

    • Use statistical models to estimate confidence intervals

  • Experimental variations:

    • Test fitness under different environmental conditions (temperature, nutrient availability, stress conditions)

    • Combine with gene expression analysis to correlate fitness effects with molecular changes

How should I structure and present data tables when analyzing YJL086C-related experiments?

Proper data presentation is crucial for clear communication of research findings:

  • Essential elements of effective data tables:

    • Create a descriptive title that relates to the specific data presented

    • Determine appropriate columns and rows based on variables being measured

    • Include clear labels with units and measurement uncertainty

    • Ensure consistent precision (same number of decimal places/significant digits)

    • Record data in a clear, obvious manner with no empty cells

  • Example structure for YJL086C expression data:

    Strain GenotypeYJL086C Expression Level (Relative Units)Growth Rate at 28°C (h⁻¹)Growth Rate at 12°C (h⁻¹)CO₂ Production (g/L)
    Wild-type1.00 ± 0.050.32 ± 0.010.09 ± 0.014.2 ± 0.3
    YJL086C-OE3.45 ± 0.120.33 ± 0.020.14 ± 0.015.7 ± 0.2
    ΔyjlØ86c0.00 ± 0.000.30 ± 0.010.04 ± 0.013.1 ± 0.2
  • Best practices for data presentation:

    • Organize data with manipulated variables in left columns and responding variables in right columns

    • Include both raw data and processed data (averages, standard deviations)

    • Ensure tables do not break across multiple pages

    • Check for correctness and clarity before finalizing

What statistical approaches are most appropriate for analyzing phenotypic differences in YJL086C-modified strains?

Selecting appropriate statistical methods is essential for robust data interpretation:

  • Comparing growth parameters:

    • t-tests for pairwise comparisons between two strains

    • ANOVA followed by post-hoc tests (e.g., Tukey's HSD) for comparing multiple strains

    • Repeated measures ANOVA for time-course experiments

  • Analyzing competition assay data:

    • Log-ratio tests to evaluate changes in strain proportions over time

    • Calculation of selection coefficients to quantify fitness differences

  • Correlation analysis:

    • Pearson or Spearman correlation to assess relationships between YJL086C expression and phenotypic parameters

    • Multiple regression to account for confounding variables

  • Experimental design considerations:

    • Ensure sufficient biological and technical replicates (n≥3)

    • Account for batch effects and other sources of variation

    • Consider power analysis to determine appropriate sample sizes

  • Visualization approaches:

    • Growth curves with error bars

    • Box plots for comparing distributions

    • Scatterplots with regression lines for correlation analysis

How does YJL086C function in the context of cold stress response?

Based on multicopy suppression screening studies, YJL086C appears to play a role in cold stress adaptation in S. cerevisiae:

  • Current understanding:

    • High copy number of YJL086C has been shown to improve growth at low temperatures (12°C)

    • This effect may be independent of known cold response mechanisms involving Tat2p and Gap1p abundance

  • Experimental approach for further investigation:

    • Compare transcriptomic profiles of wild-type and YJL086C-overexpressing strains at normal and low temperatures

    • Analyze protein-protein interactions that may change under cold stress

    • Perform metabolomic analysis to identify pathways affected by YJL086C under cold conditions

  • Integration with other cold-responsive genes:

    • Examine genetic interactions with known cold-responsive genes

    • Test epistatic relationships through double mutant analysis

    • Investigate potential regulatory roles in cold-responsive pathways

What approaches can be used to study potential genetic interactions between YJL086C and other genes?

Understanding genetic interactions provides insights into functional relationships:

  • Synthetic genetic array (SGA) analysis:

    • Cross YJL086C deletion strain with a library of deletion mutants

    • Identify synthetic lethal or synthetic sick interactions

    • Map YJL086C into functional networks based on interaction patterns

  • Multicopy suppression screening:

    • Test whether YJL086C overexpression can suppress phenotypes of other mutants

    • Screen for genes that, when overexpressed, can suppress YJL086C deletion phenotypes

  • Double mutant analysis:

    • Create strains with YJL086C deletion combined with deletions of functionally related genes

    • Analyze phenotypes for evidence of epistasis or other genetic relationships

  • Transcriptomic analysis:

    • Compare gene expression changes in wild-type, YJL086C deletion, and overexpression strains

    • Identify genes co-regulated with YJL086C under various conditions

  • Data integration approach:

    • Combine results from multiple experimental approaches

    • Use computational methods to predict functional relationships

    • Validate key predictions with targeted experiments

How can understanding YJL086C function contribute to improving yeast strains for research applications?

The characterization of YJL086C has potential to enhance yeast strains for various applications:

  • Improved cold tolerance:

    • Engineering strains with optimized YJL086C expression could enhance growth and metabolic activity at low temperatures

    • This may be particularly valuable for cold fermentation processes

  • Enhanced stress resistance:

    • If YJL086C is involved in general stress responses, its optimization could improve strain resilience

    • This could lead to more robust experimental systems for challenging conditions

  • Metabolic engineering applications:

    • Understanding YJL086C's role in metabolism could inform strategies for optimizing metabolic pathways

    • This may be particularly relevant if YJL086C affects carbon source utilization, as suggested by improved growth on maltose in engineered strains

  • Synthetic biology tools:

    • YJL086C could serve as a module in synthetic regulatory networks

    • Its promoter or regulatory elements might be useful in circuit design

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.