Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJL120W (YJL120W)

Shipped with Ice Packs
In Stock

Description

Putative Roles

  • Metal Ion Sensitivity: Deletion of YJL120W confers sensitivity to synthetic tripeptide arsenicals (e.g., GSAO), suggesting a role in detoxification or membrane transport .

  • Vacuolar ATPase Association: Indirect links to vacuolar ATPase subunits (VMA genes) imply potential involvement in pH regulation or ion homeostasis .

  • CK2 Pathway Interactions: While not directly studied, CK2 regulatory subunits (CKB1, CKB2) influence metal ion toxicity pathways (e.g., Al³⁺, Zn²⁺ uptake), which may intersect with YJL120W’s function .

Phenotypic Data

  • Deletion Strains: No growth defects under standard conditions but show altered sensitivity to arsenicals and heavy metals .

  • Subcellular Localization: Predicted membrane localization supports transport-related hypotheses .

Research Applications

  • Mechanistic Studies: Used to investigate membrane protein dynamics and metal ion homeostasis .

  • Protein Interaction Networks: Screens for binding partners in vacuolar or stress-response pathways .

  • Antibody Validation: Serves as an antigen for antibody specificity testing .

Controversies and Limitations

  • Dubious Gene Status: Overlap with RPE1 raises questions about its independent functionality .

  • Uncharacterized Pathways: No direct evidence links YJL120W to specific metabolic or signaling cascades .

  • Commercial Variability: Host system choices (e.g., E. coli vs. mammalian cells) may affect post-translational modifications and experimental outcomes .

Future Directions

  • CRISPR-Cas9 Knock-In Studies: To confirm localization and interaction partners.

  • Structural Elucidation: Cryo-EM or X-ray crystallography to resolve membrane topology.

  • Comparative Genomics: Analyze orthologs in other fungi to infer conserved functions.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, kindly indicate them during order placement. We will prepare the product according to your request.
Lead Time
Delivery times may vary based on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
YJL120W; J0734; Putative uncharacterized protein YJL120W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJL120W
Target Protein Sequence
MTFATQVGEVRSKDTGSYNWFDHFFLCVYLALGISKWPSCMKLYRVCFIFLFTGGFFLFW LSYNRDHERSSSLRIKKVPIHIQKSDYFPSSTWIAVLVFSWRHIFCF
Uniprot No.

Target Background

Database Links

STRING: 4932.YJL120W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YJL120W and why is it classified as a "dubious ORF"?

YJL120W is classified as a dubious open reading frame in the Saccharomyces cerevisiae genome, meaning it is unlikely to encode a functional protein based on available experimental and computational evidence . This classification stems from several factors, including lack of conservation across closely related species, absence of experimental evidence for expression, and/or potential overlapping with other known genes. Despite this classification, the sequence exists in the reference genome of S. cerevisiae strain S288C and can be expressed recombinantly for research purposes .

Where is YJL120W located in the S. cerevisiae genome?

YJL120W is located on chromosome X of the S. cerevisiae genome. As indicated by its systematic name, it is found on the Watson (W) strand of chromosome J, and is the 120th ORF from the centromere on that strand . The Saccharomyces Genome Database (SGD) provides the exact genomic coordinates and context for this locus, including neighboring genes and regulatory regions. Researchers can access this information through the SGD website to understand the genomic context of YJL120W .

What expression systems are recommended for recombinant YJL120W production?

For recombinant expression of YJL120W, E. coli-based expression systems have been successfully employed . When expressing membrane proteins like YJL120W, several considerations should be addressed:

  • Vector selection: Vectors with strong inducible promoters (T7, tac) are typically used for maximum control over expression timing.

  • Tag placement: N-terminal tags (such as the 10xHis tag described in the product information) are often preferred for membrane proteins to ensure accessibility for purification .

  • Expression conditions: Lower temperatures (16-25°C) and reduced inducer concentrations may improve proper folding and membrane integration.

  • Host strain selection: Specialized E. coli strains like C41(DE3) or C43(DE3) that are adapted for membrane protein expression may yield better results.

For research requiring post-translational modifications or native-like membrane integration, yeast-based expression systems similar to those used for recombinant vaccine development may be considered , though these typically have lower yields than bacterial systems.

What purification strategies are effective for recombinant YJL120W?

Purification of membrane proteins like YJL120W presents unique challenges requiring specialized approaches:

Purification StageRecommended MethodCritical Considerations
Membrane IsolationDifferential centrifugationBuffer composition crucial for membrane integrity
SolubilizationDetergent screening (DDM, LDAO, etc.)Detergent selection affects protein stability
Affinity PurificationNi-NTA chromatography (for His-tagged protein) Imidazole concentration optimization
Further PurificationSize exclusion chromatographyDetergent must be maintained throughout
Quality ControlSDS-PAGE, Western blot, Mass spectrometryConfirms identity and purity

The recombinant YJL120W protein available commercially is provided in either liquid form or as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . This formulation suggests optimization for stability while maintaining native-like conformation.

What analytical methods are suitable for studying membrane proteins like YJL120W?

Membrane proteins require specialized analytical approaches:

  • Structural analysis: Techniques include X-ray crystallography (challenging for membrane proteins), cryo-electron microscopy, and NMR for smaller membrane proteins or domains.

  • Functional characterization: Despite being classified as dubious, potential functions can be investigated using:

    • Electrophysiology if channel or transporter activity is suspected

    • Binding assays for potential interacting partners

    • Localization studies using fluorescent tags

  • Interaction studies: Modified yeast two-hybrid systems adapted for membrane proteins, co-immunoprecipitation with careful detergent selection, or proximity labeling approaches.

  • In silico analysis: Homology modeling, even with limited sequence similarity, can provide structural insights when combined with molecular dynamics simulations in membrane mimetics.

How can researchers determine if a dubious ORF like YJL120W has biological significance?

Despite classification as dubious, several approaches can assess potential biological relevance:

  • Transcriptional analysis: RNA-seq or qPCR can detect if the ORF is transcribed under specific conditions, similar to how gene expression changes were analyzed in recombinant S. cerevisiae under different metabolic conditions .

  • Translational evidence: Ribosome profiling or proteomics can identify if translation occurs in vivo.

  • Genetic manipulation: CRISPR-Cas9 or traditional homologous recombination to delete, mutate, or tag the genomic locus, followed by phenotypic analysis.

  • Evolutionary conservation: While dubious ORFs typically lack conservation, sensitive sequence analysis across diverse fungal species might reveal conserved features or domains.

  • Condition-specific relevance: Testing under diverse environmental and stress conditions may reveal condition-specific expression or phenotypes, as seen with other yeast genes that are differentially regulated under various metabolic states .

What bioinformatic tools are most useful for analyzing putative proteins like YJL120W?

Comprehensive bioinformatic analysis employs multiple complementary approaches:

Analysis TypeRecommended ToolsApplication to YJL120W
Sequence AnalysisBLAST, HMMERIdentify distant homologs
Domain PredictionInterProScan, SMARTDetect conserved domains
Membrane TopologyTMHMM, PhobiusPredict transmembrane regions
Structural PredictionAlphaFold, I-TASSERGenerate 3D structural models
Functional InferenceSTRING , GeneMANIAIdentify potential interaction partners
Evolutionary AnalysisPAML, FunDiDetect selection signatures

For YJL120W specifically, STRING database analysis may reveal potential functional associations with other proteins, though limited by its dubious status . The membrane localization prediction suggests focusing on tools optimized for transmembrane protein analysis.

How can researchers experimentally validate or refute the "dubious ORF" classification?

Validating or refuting YJL120W's dubious classification requires multiple lines of evidence:

  • Transcriptional evidence: Comprehensive RNA-Seq under diverse conditions to detect any condition-specific expression.

  • Translational evidence: Ribosome profiling and targeted mass spectrometry can confirm whether the predicted protein is actually synthesized in vivo.

  • Functional assays: Phenotypic analysis of deletion strains under diverse conditions, including stresses that might reveal cryptic functions.

  • Conservation analysis: Deep comparative genomics across fungi to identify any conserved elements that might suggest functionality.

  • Structural biology: Expression, purification, and structural determination might reveal features consistent with functional proteins.

A systematic approach combining multiple methodologies provides the strongest evidence. Researchers should note that absence of evidence is not evidence of absence; functional relevance might be condition-specific or subtle.

How does functional genomics inform our understanding of dubious ORFs like YJL120W?

Large-scale functional genomics approaches reveal important insights about putative proteins:

  • Pooled fitness assays: Genome-wide deletion or CRISPR screening under hundreds of conditions can identify subtle phenotypes missed in targeted studies.

  • Synthetic genetic arrays: Systematic genetic interaction mapping can place dubious ORFs in functional contexts, even without knowing their precise function.

  • Proteome-wide interaction studies: High-throughput approaches like BioID or proximity labeling can identify physical interactions that suggest function.

  • Multi-omics integration: Combining transcriptomics, proteomics, metabolomics, and genetic data can reveal correlations that suggest functional roles.

For YJL120W specifically, similar approaches to those used in studying yeast metabolic adaptation could be applied to determine if this putative protein plays any role in cellular processes under specific conditions .

What are the implications of studying dubious ORFs for genome annotation and understanding?

Research on dubious ORFs has significant implications for genomics:

  • Annotation refinement: Investigating dubious ORFs like YJL120W can lead to improved genome annotation, either confirming their non-functional status or discovering cryptic functions.

  • Evolutionary insights: Understanding why some sequences persist despite appearing non-functional provides insights into genome evolution.

  • Genomic dark matter: Dubious ORFs represent part of the "dark matter" of genomes—sequences with no known function but potential biological relevance.

  • Regulatory elements: Some apparently non-coding regions may have regulatory functions rather than encoding proteins.

  • Methodological advances: Studying challenging cases drives development of more sensitive analytical methods.

The systematic study of these regions contributes to a more complete understanding of genome function beyond the canonical protein-coding genes.

How do membrane-associated dubious ORFs like YJL120W differ from soluble dubious ORFs in terms of research approach?

Membrane-associated dubious ORFs present distinct research challenges:

  • Expression difficulties: Membrane proteins typically express at lower levels and require specialized expression systems.

  • Purification complexity: Detergent selection and optimization is critical for maintaining native structure.

  • Structural analysis challenges: Crystallization is more difficult, often requiring specialized techniques like lipidic cubic phase crystallization.

  • Functional assays: Testing function may require reconstitution into artificial membranes or liposomes.

  • Interaction landscape: Interaction partners are often other membrane proteins, requiring specialized interaction detection methods.

  • Localization studies: Confirming predicted membrane localization requires careful experimental design to distinguish specific from non-specific membrane association.

Researchers studying YJL120W should employ approaches optimized for membrane proteins while remaining cognizant of its dubious classification.

What quality control measures are essential when working with recombinant YJL120W?

Rigorous quality control is crucial for research reproducibility:

  • Protein identity verification: Mass spectrometry to confirm the correct sequence.

  • Purity assessment: SDS-PAGE, size exclusion chromatography, and dynamic light scattering.

  • Structural integrity: Circular dichroism to assess secondary structure, particularly important for membrane proteins.

  • Homogeneity: Analytical ultracentrifugation or native PAGE to assess oligomeric state.

  • Functional activity: If any functional hypotheses exist, activity assays should be established.

  • Stability monitoring: Regular testing of aliquots to ensure consistent properties over time. Commercial preparations of YJL120W have specific storage recommendations (-20°C/-80°C) to maintain stability, with liquid forms having a shelf life of approximately 6 months and lyophilized forms lasting about 12 months .

How can contradictory data about dubious ORFs be reconciled in research?

When facing contradictory data about YJL120W or similar dubious ORFs:

  • Methodological differences: Carefully analyze differences in experimental approaches that might explain contradictory results.

  • Condition-specific effects: Consider whether discrepancies stem from different experimental conditions, as seen in differential gene expression under varied metabolic conditions in yeast .

  • Strain variations: Genetic background differences between yeast strains can affect results; S288C (the reference strain) may differ from other laboratory or wild strains .

  • Resolution through orthogonal approaches: Apply multiple independent methods to address the same question.

  • Quantitative vs. qualitative differences: Some contradictions may reflect differences in magnitude rather than fundamental disagreement.

  • Publication bias: Consider whether negative results might be underrepresented in the literature.

Systematic documentation and transparent reporting of all experimental conditions and results are essential for resolving contradictions in the field.

What model systems are most appropriate for studying the potential functions of YJL120W?

Selecting appropriate model systems depends on research objectives:

  • S. cerevisiae genetic studies: The native host provides the most relevant genetic context, with tools like the YeastORF collection or CRISPR-Cas9 enabling sophisticated genetic manipulations.

  • Heterologous expression systems: E. coli, insect cells, or mammalian cells can be used for high-yield protein production, though with potential differences in post-translational modifications and membrane composition .

  • In vitro reconstitution: Purified protein reconstituted into liposomes or nanodiscs allows controlled study of potential membrane-associated functions.

  • Computational models: In silico approaches like molecular dynamics simulations can provide insights into potential structural dynamics.

Each system offers distinct advantages, and multiple complementary approaches often provide the most comprehensive understanding.

How does research on YJL120W contribute to our understanding of genome evolution?

Studying dubious ORFs like YJL120W provides evolutionary insights:

  • Genomic innovation: Understanding whether apparently non-functional sequences can evolve new functions.

  • Selection pressures: Determining what forces maintain or eliminate dubious ORFs over evolutionary time.

  • Annotation precision: Refining our ability to distinguish between functional and non-functional genomic elements.

  • Comparative genomics: Analysis across multiple yeast species can reveal whether YJL120W is species-specific or has homologs in related organisms.

  • Regulatory evolution: Exploring whether dubious ORFs might play roles in gene regulation rather than encoding functional proteins.

This research contributes to foundational questions in genome biology and evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.