Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJL152W (YJL152W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
YJL152W; J0628; Putative uncharacterized protein YJL152W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJL152W
Target Protein Sequence
MPHLAAEAHTWPPHISHSTLSIPHPTPEHRHVFHKKDVKNKRNEEKGNNLLYVLFRTTVI KSSFRSLSTAGRELLFVVHQGHIGTGLIVFIICWRLCLRFLCRVSFQVTVYGGRSRMSA
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YJL152W and what is currently known about this protein?

YJL152W is a putative uncharacterized protein from the yeast Saccharomyces cerevisiae. Current knowledge about this protein is limited, but we know it consists of 119 amino acids . The protein has been classified as "putative uncharacterized," indicating that its function has been predicted through computational methods but not experimentally verified. The protein can be produced recombinantly in E. coli expression systems with a His-tag for purification purposes . Based on available databases, YJL152W appears to have minimal expression data available in standard experimental conditions, suggesting it may be expressed under specific or rare conditions not commonly tested in high-throughput studies .

What are the basic structural features of YJL152W?

While comprehensive structural data for YJL152W is limited, the protein consists of 119 amino acids, making it a relatively small protein compared to the average yeast protein . Without experimental structural determination through techniques like X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy, researchers typically rely on computational prediction methods for initial structural insights. Methodologically, researchers should consider running the protein sequence through structure prediction algorithms (such as AlphaFold2, Rosetta, or I-TASSER) to generate hypothetical models that can inform experimental design. These predictions should be validated through biochemical techniques such as circular dichroism spectroscopy to determine secondary structure elements or limited proteolysis to identify domain boundaries.

How is the YJL152W gene organized in the S. cerevisiae genome?

YJL152W is located on chromosome X of the S. cerevisiae genome. The systematic name "YJL152W" follows the standard yeast nomenclature where "Y" denotes a yeast ORF, "J" indicates chromosome X, "L" indicates the relative position on the chromosome, "152" is the specific ORF number, and "W" indicates it is transcribed from the Watson (5' to 3') strand. For researchers studying this gene, it's important to examine its genomic context, including potential regulatory regions, neighboring genes, and conservation across related yeast species. Methodologically, researchers should use comparative genomics approaches to identify conserved regulatory elements and synteny with other yeast species, which may provide insights into its function or expression patterns.

What are the optimal conditions for recombinant expression of YJL152W?

For recombinant expression of YJL152W, E. coli has been successfully used as an expression host . Methodologically, researchers should optimize expression by testing multiple expression systems (e.g., BL21(DE3), Rosetta, SHuffle strains) to address potential codon bias issues or disulfide bond formation requirements. Induction conditions should be systematically tested, comparing IPTG concentrations (typically 0.1-1.0 mM), induction temperatures (15-37°C), and induction duration (4-24 hours). For proteins that are difficult to express in soluble form, specialized approaches include:

  • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

  • Fusion with solubility-enhancing tags (MBP, SUMO, GST)

  • Testing autoinduction media

  • Use of a yeast expression system to maintain native post-translational modifications

Based on available data, His-tagged versions of the full-length protein (1-119 amino acids) have been successfully produced , suggesting that N-terminal or C-terminal His-tags are compatible with protein folding.

What purification strategies are most effective for YJL152W protein?

For His-tagged YJL152W, the primary purification step typically involves immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-TALON resins. A methodological approach to purification would involve:

  • Cell lysis optimization: Test different buffer compositions (varying pH, salt concentration, and additives like glycerol or reducing agents)

  • IMAC purification: Optimize binding, washing, and elution conditions

  • Secondary purification: Apply size exclusion chromatography to achieve higher purity and assess oligomeric state

  • Alternative approaches: Consider ion exchange chromatography if the protein's theoretical pI indicates favorable binding

Researchers should monitor protein quality through multiple methods, including SDS-PAGE, western blotting, and mass spectrometry verification of the intact mass. Given that YJL152W is uncharacterized, it's particularly important to verify protein identity through peptide mass fingerprinting or N-terminal sequencing.

What approaches can be used to determine the potential function of the uncharacterized YJL152W protein?

For uncharacterized proteins like YJL152W, a multi-faceted approach is necessary. Methodologically, researchers should:

  • Conduct bioinformatic analyses: Use tools like BLAST, HHpred, or AlphaFold-Multimer to identify distant homologs or structural similarities

  • Perform gene knockout/knockdown studies: Create deletion strains and assess phenotypes across various conditions

  • Use protein-protein interaction methods: Employ yeast two-hybrid, affinity purification-mass spectrometry, or BioID proximity labeling to identify interaction partners

  • Apply localization studies: Use fluorescently-tagged versions to determine subcellular localization

  • Conduct transcriptomics and proteomics: Compare wild-type and knockout strains to identify affected pathways

Protein-protein interaction studies are particularly valuable for uncharacterized proteins, as they can place the protein within known cellular pathways and provide functional context.

How can researchers design experiments to identify potential interacting partners of YJL152W?

Identifying protein interaction partners is crucial for understanding the function of uncharacterized proteins. Methodologically, researchers should employ multiple complementary approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express His-tagged or TAP-tagged YJL152W in yeast

    • Perform crosslinking to capture transient interactions

    • Conduct tandem purification under native conditions

    • Identify co-purifying proteins by mass spectrometry

  • Proximity-dependent labeling:

    • Generate BioID or TurboID fusions of YJL152W

    • Express in yeast to biotinylate proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Yeast two-hybrid screening:

    • Test direct interactions with candidate proteins

    • Perform library screening to identify novel interactors

  • Co-localization studies:

    • Generate fluorescently tagged YJL152W

    • Perform co-localization with markers of cellular compartments

Researchers should validate identified interactions through reciprocal pulldowns, co-immunoprecipitation, or bimolecular fluorescence complementation.

What genetic approaches can help elucidate the function of YJL152W?

Genetic approaches offer powerful insights into protein function. Methodologically, researchers should:

  • Generate knockout strains (YJL152W deletion mutants):

    • Assess growth phenotypes under various conditions (temperature, nutrient availability, stress)

    • Perform competition assays with wild-type strains to detect subtle fitness effects

    • Conduct high-throughput phenotypic assays using deletion collections

  • Synthetic genetic interactions:

    • Perform synthetic genetic array (SGA) analysis to identify genetic interactions

    • Generate double mutants with genes in suspected related pathways

    • Conduct dosage suppression screens to identify functional relationships

  • Overexpression studies:

    • Create strains overexpressing YJL152W

    • Assess growth phenotypes and molecular consequences of overexpression

  • Complementation studies:

    • Test if homologs from other species can complement the deletion phenotype

These genetic approaches should be coupled with molecular phenotyping (transcriptomics, proteomics, metabolomics) to provide mechanistic insights into the observed phenotypes.

How can structural biology techniques be applied to study YJL152W?

Despite the challenges of working with uncharacterized proteins, structural biology approaches can provide valuable insights. Methodologically, researchers should consider:

These approaches should be prioritized based on protein yield, stability, and initial biophysical characterization.

What systems biology approaches can place YJL152W in a broader cellular context?

For uncharacterized proteins, systems-level analyses can provide contextual information about function. Methodologically, researchers should:

  • Transcriptomic profiling:

    • Compare wild-type and YJL152W deletion strains

    • Analyze expression patterns across multiple conditions

    • Identify co-expressed genes using databases and new experiments

  • Metabolomic analysis:

    • Identify metabolic changes in deletion strains

    • Use stable isotope labeling to track specific metabolic pathways

  • Proteome-wide interaction mapping:

    • Integrate YJL152W into protein interaction networks

    • Analyze network properties (centrality, clustering)

  • Synthetic genetic interaction mapping:

    • Identify genetic interactions through systematic double-mutant analysis

    • Map genetic interaction profile similarity to known genes

  • Evolutionary analysis:

    • Examine conservation patterns across species

    • Identify co-evolutionary relationships with other proteins

Researchers should integrate these datasets to build predictive models of YJL152W function and test these models experimentally.

How can advanced imaging techniques contribute to understanding YJL152W function?

Advanced imaging approaches can provide insights into protein localization, dynamics, and interactions. Methodologically, researchers should consider:

  • Super-resolution microscopy:

    • Techniques like STORM, PALM, or SIM can resolve structures beyond the diffraction limit

    • Tag YJL152W with appropriate fluorophores for super-resolution imaging

    • Co-image with markers for cellular compartments

  • Live-cell imaging:

    • Generate fluorescent protein fusions (ensuring functionality)

    • Track localization changes during the cell cycle or under stress

    • Employ FRAP (Fluorescence Recovery After Photobleaching) to measure mobility

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence localization with ultrastructural context

    • Particularly useful if YJL152W associates with specific organelles

  • Single-molecule tracking:

    • Follow individual molecules to determine diffusion characteristics

    • Identify potential binding sites or restricted movements

  • FRET-based interaction studies:

    • Confirm protein interactions in living cells

    • Measure interaction dynamics in response to cellular signals

These imaging approaches should be combined with appropriate controls and quantitative analysis to extract meaningful biological insights.

How should researchers analyze data from multi-omics studies involving YJL152W?

Multi-omics studies generate complex datasets that require sophisticated analysis approaches. Methodologically, researchers should:

  • Differential expression analysis:

    • Compare wild-type and YJL152W deletion strains

    • Use appropriate statistical methods (limma, DESeq2) with multiple testing correction

    • Validate key findings using orthogonal methods (qPCR, western blots)

  • Pathway enrichment analysis:

    • Identify biological processes affected by YJL152W deletion

    • Use databases like GO, KEGG, or Reactome

    • Consider both over-representation analysis and gene set enrichment analysis

  • Network analysis:

    • Place YJL152W in the context of protein-protein interaction networks

    • Identify network modules affected by YJL152W deletion

    • Use algorithms like WGCNA for co-expression network analysis

  • Integration of multiple data types:

    • Combine transcriptomic, proteomic, and metabolomic data

    • Use methods like multi-omics factor analysis or DIABLO

    • Identify concordant signals across different data types

  • Visualization strategies:

    • Create integrated visualizations that highlight relationships between datasets

    • Use dimensionality reduction techniques (PCA, t-SNE, UMAP)

Researchers should consider consulting with computational biologists to ensure appropriate statistical approaches and to assist with integration of diverse data types.

What are common pitfalls in interpreting data for uncharacterized proteins like YJL152W?

Working with uncharacterized proteins presents unique challenges in data interpretation. Researchers should be aware of these methodological pitfalls:

  • Over-reliance on sequence homology:

    • Distant homologs may have divergent functions

    • Function prediction should integrate multiple lines of evidence

    • Consider structural similarity even in the absence of sequence similarity

  • Misinterpreting phenotypes:

    • Deletion phenotypes may be indirect effects

    • Consider compensatory mechanisms that mask phenotypes

    • Use conditional alleles to distinguish primary from secondary effects

  • Artifacts in protein interaction studies:

    • Tags may interfere with native interactions

    • Common contaminants may appear as false positives

    • Crosslinking can create non-physiological interactions

  • Overinterpretation of correlative data:

    • Co-expression doesn't necessarily indicate functional relationships

    • Genetic interactions can occur between functionally distant genes

    • Localization patterns may change based on conditions or tags

  • Publication bias:

    • Consider that negative results are often unpublished

    • Be cautious of functional assignments based on limited evidence

Researchers should triangulate findings using multiple independent approaches and maintain appropriate skepticism when interpreting results for previously uncharacterized proteins.

What strategies can researchers employ when YJL152W proves difficult to express or purify?

Uncharacterized proteins often present challenges in expression and purification. Methodologically, researchers should systematically troubleshoot:

  • Expression optimization:

    • Test multiple expression vectors with different promoters

    • Try different fusion tags (MBP, SUMO, Trx) to enhance solubility

    • Adjust expression temperature and induction conditions

    • Consider expression in yeast rather than E. coli

  • Solubility enhancement:

    • Screen buffers using high-throughput approaches

    • Add stabilizing agents (glycerol, arginine, specific ions)

    • Try detergents or amphipols if hydrophobic regions are present

    • Consider refolding from inclusion bodies if necessary

  • Purification troubleshooting:

    • Test different chromatography approaches

    • Implement on-column refolding if needed

    • Consider limited proteolysis to identify stable domains

    • Purify with interacting partners to stabilize the protein

  • Quality assessment:

    • Use multiple techniques to verify proper folding (CD spectroscopy, DSF)

    • Check for aggregation using DLS or analytical SEC

    • Verify activity using functional assays where possible

Having a systematic approach to optimization, with appropriate controls at each step, is essential for success with challenging proteins.

How can researchers address the challenge of studying proteins with low or condition-specific expression?

The limited expression data for YJL152W suggests it may be expressed at low levels or under specific conditions. Methodologically, researchers can address this challenge by:

  • Condition screening:

    • Test expression across diverse growth conditions

    • Examine different stress responses (oxidative, pH, nutrient limitation)

    • Assess expression throughout the cell cycle and growth phases

  • Sensitive detection methods:

    • Use RT-qPCR for transcript detection

    • Employ targeted proteomics (SRM/MRM-MS) for protein detection

    • Implement signal amplification strategies for immunodetection

  • Endogenous tagging strategies:

    • Use CRISPR-based approaches for minimal disruption

    • Consider nanobody-based detection systems

    • Implement auxin-inducible degron tags for functional studies

  • Single-cell approaches:

    • Use single-cell RNA-seq to identify rare expressing cells

    • Implement microfluidic approaches to monitor expression in individual cells

    • Consider cell sorting to enrich for expressing populations

These approaches should be combined with appropriate controls and validation to ensure that observed signals are specific to YJL152W.

What emerging technologies could accelerate the functional characterization of YJL152W?

Several cutting-edge technologies hold promise for uncharacterized proteins. Methodologically, researchers should consider:

  • CRISPR-based approaches:

    • CRISPRi for targeted repression

    • CRISPRa for endogenous activation

    • Base editing for specific amino acid substitutions

    • Prime editing for precise genomic modifications

  • Advanced protein engineering:

    • Split protein complementation for interaction mapping

    • Optogenetic control of protein activity

    • Chemogenetic approaches for temporal control

  • New structural biology techniques:

    • Integrative structural biology combining multiple data types

    • Microcrystal electron diffraction for challenging crystals

    • Cross-linking mass spectrometry for interaction surfaces

  • Machine learning approaches:

    • Deep learning for function prediction from sequence

    • ML-based experimental design optimization

    • Automated image analysis for phenotype detection

  • Single-molecule approaches:

    • Optical tweezers for protein mechanics

    • Nanopore analysis for conformational dynamics

    • Single-molecule FRET for structural transitions

Researchers should consider collaborations with technology developers to apply these emerging approaches to challenging uncharacterized proteins.

What are the most promising comparative genomics approaches for understanding YJL152W?

Comparative genomics can provide evolutionary context for uncharacterized proteins. Methodologically, researchers should:

  • Phylogenetic profiling:

    • Determine the presence/absence pattern across species

    • Identify co-evolving genes that may share function

    • Analyze evolutionary rate to infer functional constraints

  • Synteny analysis:

    • Examine conservation of genomic neighborhood

    • Identify operons or gene clusters in related species

    • Detect horizontally transferred regions

  • Sequence conservation patterns:

    • Perform residue-level conservation analysis

    • Identify potential functional motifs or domains

    • Detect signatures of selection (dN/dS ratio)

  • Structural conservation:

    • Compare predicted structures across homologs

    • Identify conserved surface patches as potential interfaces

    • Analyze conservation of biophysical properties

  • Analysis across diverse yeast species:

    • Compare with pathogenic and industrial yeasts

    • Examine conservation in extreme environment inhabitants

    • Analyze polyploid species for subfunctionalization

These comparative approaches should be integrated with experimental data to build a comprehensive evolutionary model of YJL152W function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.