Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJL182C (YJL182C)

What is YJL182C protein and what are its basic characteristics?

YJL182C is a putative uncharacterized protein from the yeast Saccharomyces cerevisiae. It consists of 105 amino acids with the sequence: "MTGYRVIHLTGIYYTFYRRKSFFFFFLEYLHNSLRVLSWKGIITKIAASPFVIVLYFNTAFFNPFKTLYENEKKKAKKNLKLTRENASLSIRKMHQYSAIIPSGT" . The protein is classified as "uncharacterized" because its specific biological function has not been definitively established. In recombinant form, it is typically expressed with a His-tag to facilitate purification and downstream applications .

What are the optimal storage conditions for recombinant YJL182C protein?

According to available product information, recombinant YJL182C protein should be stored at -20°C/-80°C upon receipt, and aliquoting is necessary for multiple use scenarios to avoid repeated freeze-thaw cycles . For working solutions, storage at 4°C for up to one week is recommended . The protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For reconstitution, it is recommended to briefly centrifuge the vial before opening and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of glycerol (final concentration 5-50%) for long-term storage .

What expression systems are commonly used for recombinant YJL182C production?

Based on the available data, E. coli is the predominant expression system used for recombinant production of YJL182C protein . The protein is typically expressed as a full-length construct (amino acids 1-105) with an N-terminal His-tag . This bacterial expression system is widely used due to its cost-effectiveness, scalability, and relatively high protein yields. The E. coli system allows for the production of sufficient quantities of the protein for various experimental applications including structural studies, functional assays, and antibody production.

What experimental approaches are recommended for characterizing the function of uncharacterized proteins like YJL182C?

For characterizing uncharacterized proteins like YJL182C, a multi-faceted approach is recommended:

• Comparative genomics analysis: Identify potential homologs across species to infer possible functions based on evolutionary conservation.

• Protein interaction studies: Yeast two-hybrid screens, co-immunoprecipitation, or pull-down assays can identify protein partners that may provide functional insights . As noted in the protein information, interaction data for YJL182C is limited but represents a valuable approach for characterization .

• Gene deletion/knockout studies: Analyze phenotypic changes in S. cerevisiae strains with YJL182C deletions. This approach is particularly relevant as YJL182C has been included in cell wall biosynthesis studies, suggesting a potential role in this process .

• Localization studies: Use fluorescent protein tagging to determine the subcellular localization of YJL182C, which can provide clues about its function.

• Transcriptomic and proteomic profiling: Compare wild-type and YJL182C mutant strains under various conditions to identify pathways affected by its absence or overexpression.

• Structural analysis: Determine the three-dimensional structure of YJL182C using X-ray crystallography or NMR spectroscopy to identify potential functional domains.

How can researchers investigate the potential role of YJL182C in cell wall biosynthesis?

Given that YJL182C has been mentioned in the context of cell wall biosynthesis research , investigators can employ the following methodological approaches:

• Cell wall integrity assays: Expose YJL182C deletion mutants to cell wall-perturbing agents such as Congo Red (CR) and Calcofluor White (CFW) to assess sensitivity changes, as these compounds are commonly used to identify genes involved in cell wall structure and function .

• Cell wall composition analysis: Compare the β-1,3-glucan, β-1,6-glucan, and chitin content between wild-type and YJL182C mutant strains using specific enzymatic digestions and quantitative assays.

• Microscopy analysis: Employ electron microscopy to examine cell wall ultrastructure in YJL182C mutants, looking for changes in the electron-transparent inner layer or electron-dense outer layer of the cell wall .

• Gene expression profiling: Use DNA microarrays to analyze changes in gene expression in response to cell wall-damaging drugs, comparing wild-type and YJL182C mutant responses . This approach can reveal whether YJL182C is part of the cell wall integrity signaling pathway.

• Genetic interaction studies: Perform synthetic genetic array analysis to identify genetic interactions between YJL182C and known cell wall biosynthesis genes, which can place YJL182C in specific cell wall-related pathways.

What bioinformatic approaches can help predict the function of YJL182C based on its sequence?

Several computational approaches can provide insights into the potential function of YJL182C:

• Sequence homology analysis: Use tools like BLAST, HMMER, and PSI-BLAST to identify distant homologs across species, which might have better-characterized functions.

• Protein domain prediction: Tools such as InterPro, Pfam, and SMART can identify conserved domains that might suggest molecular functions.

• Secondary structure prediction: Algorithms like PSIPRED can predict protein secondary structure elements, which might reveal structural motifs associated with specific functions.

• 3D structure prediction: Tools like AlphaFold or RoseTTAFold can generate structural models that might reveal similarity to proteins with known functions, even in the absence of significant sequence similarity.

• Molecular docking simulations: Predict potential binding partners or substrates based on the structural model.

• Functional association networks: Databases like STRING can suggest functional associations based on genomic context, co-expression data, and text mining of scientific literature.

How can researchers resolve contradictory findings about protein functions in the biomedical literature?

When researchers encounter contradictory findings about proteins like YJL182C, several methodological approaches can help resolve these discrepancies:

What are the best practices for designing experiments to study YJL182C expression under different environmental conditions?

To effectively study YJL182C expression under varying environmental conditions, researchers should:

• Establish reliable detection methods: Develop specific antibodies against YJL182C or create tagged versions (e.g., GFP-YJL182C) that can be reliably detected.

• Design comprehensive time-course experiments: Monitor expression at multiple time points to capture dynamic changes in response to environmental stimuli.

• Include appropriate controls: Use wild-type strains and strains with known cell wall-related gene deletions as references.

• Employ multiple detection methods: Combine techniques such as RT-qPCR, Western blotting, and fluorescence microscopy to provide complementary data on expression levels and localization.

• Consider experimental design rigor: As noted in search result , careful experimental design for transcriptomic studies is crucial. For YJL182C studies, this might include:

  Experimental Factor	Considerations
  Strain selection	Use isogenic strains; consider both haploid and diploid backgrounds
  Growth conditions	Define precise media composition, temperature, pH, and growth phase
  Stress conditions	Apply standardized doses of cell wall-perturbing agents
  Biological replicates	Minimum of three independent experiments
  Technical replicates	Multiple measurements per biological sample

• Apply appropriate statistical analyses: Use robust statistical methods to identify significant changes in expression levels across conditions.

What CRISPR-Cas9 strategies are most effective for studying YJL182C function in S. cerevisiae?

CRISPR-Cas9 technology offers powerful approaches for studying YJL182C:

• Complete gene knockout: Design guide RNAs targeting the YJL182C coding sequence to create clean deletion mutants. For this 105-amino acid protein, targeting the 5' region of the gene is typically most effective.

• Domain-specific mutations: Use CRISPR-Cas9 with homology-directed repair to introduce specific mutations in predicted functional domains of YJL182C, allowing for structure-function analysis.

• Promoter modification: Engineer the native YJL182C promoter to create conditional expression systems that allow for temporal control of gene expression.

• Tagging strategies: Use CRISPR-Cas9 to introduce fluorescent or affinity tags at the genomic locus, ensuring expression under native regulatory control.

• Multiplexed gene editing: Simultaneously target YJL182C and other genes suspected to function in related pathways to investigate genetic interactions.

• Base editing approaches: For more subtle genetic modifications, CRISPR base editors can be used to introduce specific nucleotide changes without inducing double-strand breaks.

How can researchers design effective protocols for studying potential post-translational modifications of YJL182C?

To investigate post-translational modifications (PTMs) of YJL182C, researchers should consider:

• In silico prediction: Use computational tools to predict potential modification sites in the YJL182C sequence, such as phosphorylation, glycosylation, ubiquitination, or SUMOylation sites.

• Mass spectrometry analysis: Employ high-resolution mass spectrometry techniques to identify and characterize PTMs:

  • Enrich the recombinant protein using the His-tag

  • Perform tryptic digestion followed by LC-MS/MS analysis

  • Use both collision-induced dissociation (CID) and electron-transfer dissociation (ETD) fragmentation methods

  • Compare PTM profiles under different growth conditions

• Site-directed mutagenesis: Mutate predicted modification sites to confirm their importance for protein function.

• Specific PTM detection methods: Use modification-specific antibodies or chemical labeling techniques to detect particular modifications.

• Functional impact assessment: Compare wild-type YJL182C with mutants lacking specific modification sites to determine the functional significance of the PTMs.

What strategies can researchers use to integrate multi-omics data for understanding YJL182C function?

For comprehensive understanding of YJL182C function, researchers can integrate multiple types of omics data using these approaches:

• Data integration frameworks: Implement computational frameworks that can harmonize heterogeneous data types (genomics, transcriptomics, proteomics, metabolomics) to provide a systems-level view of YJL182C function.

• Network analysis: Construct functional networks that incorporate protein-protein interaction data, co-expression data, and genetic interaction data to position YJL182C within the broader cellular context.

• Pathway enrichment analysis: Identify biological pathways that are statistically enriched among genes/proteins that interact with or are co-expressed with YJL182C.

• Temporal data integration: Analyze time-series data across multiple omics layers to understand the dynamic role of YJL182C in cellular responses.

• Cross-species comparative analysis: Integrate data from multiple yeast species to identify evolutionarily conserved functions.

• Data visualization tools: Employ advanced visualization techniques to represent complex multi-dimensional data in an interpretable format.

How can researchers effectively compare YJL182C with homologous proteins in other yeast species?

To conduct robust comparative analyses of YJL182C across yeast species:

• Sequence-based homology detection: Use sensitive sequence alignment tools (HMMER, PSI-BLAST) to identify potential homologs in other yeast species, considering that uncharacterized proteins often have low sequence conservation.

• Phylogenetic analysis: Construct phylogenetic trees to understand the evolutionary relationships between YJL182C and its homologs.

• Synteny analysis: Examine the conservation of genomic context around YJL182C across different yeast species, which can provide functional insights even when sequence conservation is limited.

• Structural comparison: Compare predicted three-dimensional structures of YJL182C and its homologs, as structural conservation often exceeds sequence conservation.

• Functional complementation experiments: Test whether homologs from other species can rescue phenotypes in S. cerevisiae YJL182C deletion mutants.

• Comparative expression analysis: Compare expression patterns of YJL182C homologs under similar conditions across species to identify conserved regulatory patterns.

What emerging technologies might accelerate characterization of uncharacterized proteins like YJL182C?

Several cutting-edge technologies hold promise for characterizing proteins like YJL182C:

• AI-powered structure prediction: Tools like AlphaFold2 can provide high-confidence structural models that may reveal functional insights even for proteins with no characterized homologs.

• Single-cell proteomics: Emerging technologies for protein analysis at the single-cell level can reveal cell-to-cell variation in YJL182C expression and localization.

• Proximity labeling techniques: Methods like BioID or APEX can identify proteins in close proximity to YJL182C in vivo, providing spatial context for functional studies.

• Cryo-electron tomography: This technique can visualize the cellular context of YJL182C at near-atomic resolution, potentially revealing its role in supramolecular assemblies.

• Long-read transcriptomics: These approaches can identify previously uncharacterized transcripts and isoforms related to YJL182C.

• ChatGPT and Large Language Models: Advanced AI tools can help researchers synthesize knowledge across disparate sources and generate hypotheses about protein function. As noted in search result , these tools can enhance scientific writing and research planning, potentially accelerating the characterization of proteins like YJL182C .

How can researchers contribute to community resources for studying uncharacterized yeast proteins?

Researchers working on YJL182C and similar proteins can enhance community resources by:

• Data deposition: Submit all experimental data to appropriate repositories (GenBank, PDB, ProteomeXchange, etc.) with comprehensive metadata.

• Protocol sharing: Publish detailed protocols on platforms like protocols.io to enable reproducibility.

• Strain and plasmid distribution: Deposit strains and constructs in public repositories like Addgene or the Yeast Genetic Resource Center.

• Preprint publication: Share findings rapidly through preprint servers to accelerate knowledge dissemination.

• Open notebook science: Consider maintaining open research notebooks to share ongoing research progress.

• Collaborative networks: Participate in research consortia focused on systematic characterization of uncharacterized yeast proteins.