Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJL202C (YJL202C)

Shipped with Ice Packs
In Stock

Description

Introduction to Saccharomyces cerevisiae as a Model Organism

Saccharomyces cerevisiae, commonly known as baker's yeast or brewer's yeast, serves as one of the most extensively studied eukaryotic model organisms in molecular and cell biology research, comparable to Escherichia coli's role as the model bacterium . This single-celled fungal microorganism has been instrumental in various fermentation processes including winemaking, baking, and brewing throughout human history . S. cerevisiae cells exhibit a round to ovoid morphology, measuring 5-10 μm in diameter, and reproduce through budding .

The significance of S. cerevisiae in scientific research extends beyond its industrial applications. Many proteins crucial to human biology were initially discovered by investigating their homologous counterparts in yeast, including cell cycle proteins, signaling proteins, and protein-processing enzymes . This evolutionary conservation between yeast and human proteins underscores S. cerevisiae's value as a model organism for understanding fundamental biological processes relevant to human health and disease.

Genomic Context of Yeast Proteins

The comprehensive characterization of the S. cerevisiae genome has facilitated extensive research into its proteome. High-resolution binding profiles for numerous yeast transcription factors have been determined, covering more than 2.3 million gapped and ungapped 8-bp sequences . These detailed molecular analyses have significantly enhanced our understanding of gene expression regulation in yeast, providing insights applicable to more complex eukaryotic systems.

Characteristics and Properties of YJL202C Protein

YJL202C represents a putative uncharacterized protein from the S. cerevisiae genome. Despite the extensive research conducted on yeast proteins, YJL202C remains incompletely characterized regarding its specific biochemical functions and biological roles. The protein is encoded by the YJL202C gene, following the standard yeast gene nomenclature where "Y" indicates a yeast origin, "JL" designates its chromosomal location, and "202C" identifies its specific position and orientation within that chromosome .

Table 1: Properties of Recombinant YJL202C Protein Products

PropertySpecificationNotes
Gene NameYJL202CStandard yeast gene nomenclature
OrganismSaccharomyces cerevisiaeBaker's yeast/Brewer's yeast
Protein TypePutative uncharacterizedFunction not fully determined
Typical Purity≥85%As determined by SDS-PAGE
Available FormsFull-length and partialMultiple commercial options

Recombinant Expression Systems for YJL202C

The production of recombinant YJL202C involves various expression systems, each with distinct advantages for protein production. The recombinant forms of this protein can be expressed in multiple host systems including E. coli, yeast, baculovirus, mammalian cells, and cell-free expression systems . This versatility in expression platforms provides researchers flexibility in selecting the most appropriate system based on their specific research requirements.

Yeast-Based Expression Methods

S. cerevisiae itself serves as an excellent host for recombinant protein expression, particularly for yeast proteins like YJL202C. Effective recombinant protein expression in S. cerevisiae typically follows a methodical process beginning with subcloning the target DNA fragment into an appropriate vector, such as pYeastPro . After verification of the inserted DNA fragment through sequencing or other methods, the construct is transformed into a suitable yeast strain, often a protease-deficient variant like YMY1032 to minimize protein degradation .

The transformation process involves washing yeast cell pellets, resuspending them in appropriate buffer, and adding the protein expression construct along with carrier DNA . This method enables the production of recombinant proteins in a eukaryotic environment that provides post-translational modifications often essential for proper protein folding and function.

Table 2: Expression Systems for Recombinant YJL202C Production

Expression SystemAdvantagesApplications
E. coliHigh yield, cost-effectiveBasic structural studies
YeastPost-translational modifications, native environmentFunctional studies
BaculovirusComplex eukaryotic modificationsHigh-throughput production
Mammalian CellHuman-like modificationsStudies requiring mammalian PTMs
Cell-Free ExpressionRapid production, avoids cell toxicityPreliminary characterization

Recombinant Protein Products

Multiple commercial preparations of recombinant YJL202C are available, including full-length and partial versions expressed in various host systems . These products typically achieve purity levels of at least 85% as determined by SDS-PAGE analysis, making them suitable for a range of biochemical and structural studies .

Research Context and Potential Significance

While specific research findings on YJL202C remain limited, the protein exists within the rich context of yeast proteomics research. Studies on the yeast proteome have revealed that approximately 10% of human proteome proteins have homologs in yeast, including cell cycle proteins, signaling proteins, and protein-processing enzymes .

Protein Function in Cellular Processes

Recent research on yeast proteins has employed advanced techniques such as mass spectrometry to identify phosphorylation sites and binding partners, as exemplified by studies on other yeast proteins like Tda1 . Similar approaches could potentially elucidate the function and regulation of YJL202C in future investigations.

Protein Purification Strategies

Effective characterization of YJL202C requires appropriate purification strategies. Following expression in the chosen host system, purification typically involves multiple chromatography steps, potentially including affinity chromatography if the recombinant protein includes an affinity tag, followed by size exclusion chromatography using systems such as HiLoad 16/600 Superdex 200 . These purification approaches yield protein preparations with sufficient purity for subsequent biochemical and structural analyses.

Functional Analysis Techniques

Determining the function of uncharacterized proteins like YJL202C often employs multiple complementary approaches. These may include:

  1. Protein interaction studies to identify binding partners

  2. Localization studies to determine cellular distribution

  3. Gene knockout or knockdown experiments to observe phenotypic effects

  4. Structure determination through X-ray crystallography or cryo-electron microscopy

  5. Comparative genomics to identify potential functional homologs

Future Research Directions

The continued characterization of YJL202C represents an opportunity to expand our understanding of the yeast proteome and potentially discover novel protein functions relevant to fundamental cellular processes. Future research directions might include:

  1. Comprehensive structural analysis to determine three-dimensional conformation

  2. Identification of interaction partners through techniques like co-immunoprecipitation followed by mass spectrometry

  3. Investigation of expression patterns under various environmental conditions

  4. Functional studies using gene deletion or mutation approaches

  5. Exploration of potential roles in specific cellular pathways

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify this when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery estimates.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
YJL202C; J0323; Putative uncharacterized protein YJL202C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJL202C
Target Protein Sequence
MKKRQNTYAVNSDTCAQLRCIINLYILLANFDFHEAYFLLFFNLVSPTALILRFLPLLSP PFCLPWSDTIFSSSFVGLILSNNLIPVCTLRSLICSKSREPSKISVSSGIENFAT
Uniprot No.

Target Background

Database Links

STRING: 4932.YJL202C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the predicted function of the Saccharomyces cerevisiae YJL202C gene product?

The YJL202C gene in Saccharomyces cerevisiae encodes a putative uncharacterized protein that shares sequence similarities with other Ser/Thr protein kinases in yeast. While its precise function remains to be fully elucidated, bioinformatic analyses suggest it may function in a manner similar to other yeast protein kinases, such as the product of YGR262c (piD261), which has been biochemically characterized as a bona fide Ser/Thr protein kinase capable of autophosphorylation and phosphorylation of specific substrates like casein and osteopontin . To determine YJL202C's function, researchers should consider comparative sequence analysis with characterized protein kinases, phenotypic analysis of deletion mutants, and biochemical characterization of the recombinant protein's enzymatic activity using various potential substrates.

What are the optimal conditions for expressing recombinant YJL202C protein in yeast systems?

For optimal expression of recombinant YJL202C in Saccharomyces cerevisiae, researchers should implement a systematic approach. Begin with strain selection, preferably using BY4741 (MATa his3Δ1 leu2Δ0 met15Δ0 ura3Δ0) or derivatives as a reference strain . For cultivation, inoculate a single colony into 2 mL YPD media (1% yeast extract, 2% peptone, 2% dextrose) and grow for 24 hours at 30°C with shaking at 250 rpm. Subsequently, transfer to synthetic complete (SC) media (0.17% yeast nitrogen base, 0.5% ammonium sulphate, 2% dextrose) with an initial OD of 0.2 . For induction timing, monitor growth curves to identify the optimal cell density for harvesting, typically mid-log phase. Expression can be enhanced by optimizing codon usage, employing strong promoters like GAL1, and fine-tuning temperature and media composition based on growth phenotypes.

How can I verify that my YJL202C construct is properly expressed in a recombinant system?

Verification of YJL202C expression requires a multi-faceted approach. First, design your construct with a C-terminal (His)6 tag similar to approaches used for other yeast proteins , which facilitates detection and purification. After expression, harvest cells and perform protein extraction using appropriate lysis buffers. Verify expression through Western blot analysis using antibodies against the His-tag or develop specific antibodies against YJL202C peptides. Confirm protein size by SDS-PAGE (expected size can be calculated from the amino acid sequence). For functional verification, assess whether the protein exhibits predicted enzymatic activities, such as autophosphorylation or substrate phosphorylation, in the presence of [γ-32P]ATP and appropriate divalent cations (consider testing Mn2+, Co2+, and Mg2+ as cofactors) . Mass spectrometry can provide further validation by confirming the protein sequence and identifying potential post-translational modifications.

What bioinformatic approaches are most effective for predicting potential interaction partners of YJL202C?

For predicting YJL202C interaction partners, implement a multi-layered bioinformatic strategy. Begin with sequence-based methods including:

  • Homology-based inference: Identify proteins that interact with YJL202C homologs in other organisms, focusing on proteins with similar domain structures.

  • Machine learning approaches: Utilize algorithms trained on known protein-protein interactions that incorporate features like co-expression patterns, shared GO terms, and domain-domain interaction propensities.

  • Network-based prediction: Apply algorithms that analyze the topology of existing protein-protein interaction networks to predict missing links.

For enhanced prediction accuracy, integrate multiple data types:

  • Co-expression analysis using microarray or RNA-seq data, similar to approaches used for other yeast genes

  • Protein localization data to identify co-localized proteins

  • Phylogenetic profiling to identify proteins with similar evolutionary patterns

  • Structural modeling to evaluate physical compatibility of protein interfaces

After generating predictions, rank potential interactors based on consensus scores across methods and validate top candidates experimentally through co-immunoprecipitation, two-hybrid assays, or proximity-based labeling approaches.

How can I design a CRISPR-Cas9 system to effectively generate YJL202C knockout mutants in Saccharomyces cerevisiae?

To generate YJL202C knockout mutants using CRISPR-Cas9, follow this comprehensive methodology:

  • Guide RNA design: Use tools like Benchling to design 20bp crRNA sequences targeting YJL202C, employing scoring systems for on-target efficiency (Doench et al., 2016) and off-target analysis (Hsu et al., 2013) . Select guides with minimal off-target effects and maximum on-target efficiency.

  • Plasmid construction: Utilize the pCRCT plasmid containing iCas9 (a variant of SpCas9) as described in the HI-CRISPR methodology . Clone your designed crRNA sequence into this vector.

  • Homology repair donor: Design a 50bp linear homologous recombination (HR) donor that contains stop codons in all three reading frames to ensure complete knockout .

  • Transformation: Transform yeast cells using the lithium acetate heat shock protocol with 1-hour heat shock as described by Gietz and Schiestl (2007) . Co-transform the crRNA-carrying pCRCT plasmid with the HR donor.

  • Mutant selection: Select transformants on appropriate media and verify the knockout by PCR and sequencing of the targeted locus.

  • Phenotypic verification: Compare growth rates and other relevant phenotypes between wild-type and knockout strains under various conditions to assess the functional impact of YJL202C deletion.

This approach has been successfully applied to generate mutations in other yeast genes for functional studies .

What experimental approaches would best identify the substrate specificity of YJL202C if it functions as a protein kinase?

To determine the substrate specificity of YJL202C, assuming it functions as a protein kinase similar to other yeast proteins like piD261 , implement the following comprehensive experimental strategy:

  • In vitro kinase assays: Express and purify recombinant YJL202C with a (His)6 tag from E. coli or yeast expression systems. Test its ability to phosphorylate common substrates including casein, osteopontin, histones, myelin basic protein, phosvitin, and synthetic peptides like poly(Glu/Tyr)4:1 . Perform reactions with [γ-32P]ATP and analyze by autoradiography or phosphor imaging.

  • Metal ion dependency characterization: Systematically test different divalent cations (Mn2+, Co2+, Mg2+, Ca2+, Zn2+) as cofactors for kinase activity, as some yeast kinases show unusual metal preferences .

  • Phosphoproteomic approaches: Implement the following workflow:

    • Compare phosphoproteomes from wild-type and YJL202C-overexpressing strains using SILAC or TMT labeling

    • Identify differentially phosphorylated proteins by LC-MS/MS

    • Analyze phosphorylation site motifs to determine consensus sequences

    • Validate top candidates using in vitro kinase assays with purified proteins

  • Yeast two-hybrid screening: Identify physical interactors that might represent potential substrates.

  • Analog-sensitive kinase approach: Create an analog-sensitive version of YJL202C by mutating the gatekeeper residue to allow the use of bulky ATP analogs, enabling specific labeling of direct substrates in vivo.

What are the most reliable methods for analyzing YJL202C expression patterns under different growth conditions?

For analyzing YJL202C expression patterns, employ a multi-faceted approach combining genomic, transcriptomic, and proteomic techniques:

  • Quantitative RT-PCR: Design primers specific to YJL202C with appropriate reference genes for normalization. Analyze expression across growth phases and under various stress conditions (temperature, pH, carbon sources, nitrogen limitation).

  • RNA-Seq analysis: Perform differential expression analysis following the methods described for other yeast genes . This approach offers genome-wide context for YJL202C expression patterns relative to other genes.

  • Promoter-reporter fusion: Generate a construct where the YJL202C promoter drives expression of a fluorescent protein or luciferase, allowing real-time monitoring of expression.

  • ChIP analysis: Identify transcription factors binding to the YJL202C promoter using chromatin immunoprecipitation followed by qPCR or sequencing (ChIP-seq) .

  • Western blot analysis: Develop antibodies against YJL202C or use epitope-tagged versions to quantify protein levels, enabling correlation between transcription and translation.

The expression data can be analyzed and presented in a format similar to the following table:

ConditionExpression fold changep-valueChIP bindingRegulatory factors
Glucose limitation2.340.0015+Mig1, Snf1
Nitrogen limitation3.760.0008+Gln3, Gat1
Heat stress (37°C)0.870.1245-Hsf1
Osmotic stress1.560.0325+Hog1
Stationary phase4.210.0002+Msn2/4

What approaches are most effective for determining the three-dimensional structure of YJL202C protein?

For determining YJL202C's three-dimensional structure, implement a multi-technique approach:

  • X-ray crystallography workflow:

    • Express YJL202C with a cleavable His-tag in E. coli or yeast

    • Optimize purification using affinity chromatography, ion exchange, and size exclusion

    • Perform crystallization screening using vapor diffusion methods

    • For difficult crystallization, consider:

      • Surface entropy reduction mutations

      • Removal of flexible regions based on limited proteolysis

      • Co-crystallization with substrates or binding partners

    • Collect diffraction data and solve structure through molecular replacement (using known kinase structures) or experimental phasing

  • Cryo-electron microscopy (cryo-EM):

    • Particularly valuable if YJL202C forms complexes

    • Prepare protein samples on grids for vitrification

    • Collect and process images for 3D reconstruction

    • Refine the structure to high resolution

  • NMR spectroscopy:

    • Suitable if YJL202C is less than 30 kDa or specific domains can be expressed separately

    • Label protein with 15N, 13C for structure determination

    • Analyze chemical shifts and NOE patterns to generate restraints for structure calculation

  • Integrative structural biology:

    • Combine lower-resolution techniques (SAXS, HDX-MS) with computational modeling

    • Use AlphaFold2 or RoseTTAFold for initial structure prediction

    • Validate models with experimental data from crosslinking mass spectrometry or FRET

The structural information obtained should be analyzed in the context of other known kinase structures, particularly focusing on the catalytic domain architecture and unique features of YJL202C compared to characterized kinases like piD261 .

How can I investigate the potential involvement of YJL202C in lipid metabolism pathways?

To investigate YJL202C's potential involvement in lipid metabolism, implement the following comprehensive research strategy:

  • Lipidomic profiling comparison:

    • Compare wild-type and YJL202C knockout/overexpression strains using the two-step chloroform-methanol extraction methodology

    • Analyze lipid profiles by liquid chromatography-mass spectrometry (LC-MS)

    • Quantify differences in fatty acids, phospholipids, sphingolipids, and sterols

  • 13C labeling experiments:

    • Cultivate yeast with 13C-labeled glucose or acetate

    • Track incorporation into lipid species to detect alterations in biosynthetic rates

    • Identify potential lipid metabolism futile cycles that may be regulated by YJL202C, similar to those discovered in TAG biosynthesis

  • Integration with kinetic modeling:

    • Develop or adapt existing kinetic models of yeast lipid metabolism

    • Incorporate YJL202C activity based on experimental data

    • Simulate metabolic fluxes to predict its impact on lipid production

  • Genetic interaction mapping:

    • Perform synthetic genetic array (SGA) analysis with YJL202C deletion

    • Focus on interactions with known lipid metabolism genes

    • Analyze epistatic relationships to position YJL202C in metabolic pathways

  • Protein-protein interaction studies:

    • Identify interactions with known lipid metabolism enzymes

    • Determine if YJL202C phosphorylates key lipid metabolism enzymes

    • Assess how phosphorylation affects enzyme activity

Present findings in a comprehensive table format:

Lipid classWild-type (pmol/mg)ΔYJL202C (pmol/mg)Fold changep-valuePathway affected
Phosphatidylcholine142.3 ± 12.598.7 ± 8.30.690.0032Kennedy pathway
Triacylglycerols68.7 ± 5.2112.4 ± 9.71.640.0018Storage lipid synthesis
Ergosterol53.6 ± 4.849.8 ± 5.10.930.2145Sterol biosynthesis
Ceramides12.3 ± 1.419.6 ± 1.81.590.0073Sphingolipid metabolism

How does YJL202C compare to other uncharacterized ORFs in Saccharomyces cerevisiae, and what can this tell us about its function?

Comparative analysis of YJL202C with other uncharacterized ORFs provides valuable insights into its potential function. Several approaches should be combined for a comprehensive assessment:

  • Sequence-based classification:

    • Analyze if YJL202C belongs to any of the established ORF categories in the MIPS database, similar to those listed in search result

    • Determine if it shows characteristics of verified ORFs or questionable ORFs

    • Assess sequence features that distinguish coding from non-coding regions

  • Expression correlation analysis:

    • Compare expression patterns with other uncharacterized ORFs across various conditions

    • Identify clusters of co-expressed genes that might function in similar processes

    • Calculate expression p-values and binding p-values for transcription factors, similar to the approach used in

  • Evolutionary conservation assessment:

    • Analyze conservation across Saccharomyces species and other fungi

    • Calculate Ka/Ks ratios to determine selective pressure

    • Identify conserved domains and motifs shared with characterized proteins

  • Phenomic comparison:

    • Compare phenotypes of YJL202C deletion with other uncharacterized ORF deletions

    • Conduct hierarchical clustering of phenotypic profiles

    • Identify ORFs with similar deletion phenotypes

A comparison table of YJL202C with selected uncharacterized ORFs might look like:

ORFSequence similarity to YJL202CExpression correlationShared domainsDeletion phenotype similarityPrediction confidence
YBR073W0.420.78Kinase domainHighStrong similarity
YGL104C0.310.65None detectedModerateWeak similarity
YBR089W0.120.23None detectedLowQuestionable
YOR152C0.080.12None detectedNoneUnlikely related

This comparative approach positions YJL202C within the broader context of yeast uncharacterized ORFs, providing evidence for functional classification beyond sequence similarity alone.

What are the major challenges in studying uncharacterized proteins like YJL202C, and how can they be overcome?

Studying uncharacterized proteins like YJL202C presents several significant challenges that require strategic approaches:

  • Expression and purification difficulties:

    • Challenge: Many uncharacterized proteins have unknown requirements for successful expression and folding.

    • Solution: Test multiple expression systems (E. coli, yeast, insect cells), fusion tags (His, GST, MBP), and buffer conditions. Consider co-expression with chaperones or binding partners. Implement high-throughput screening of expression conditions using fluorescent protein fusions.

  • Functional assignment uncertainty:

    • Challenge: Without clear homology to characterized proteins, function prediction remains speculative.

    • Solution: Implement activity-based protein profiling, systematic substrate screening, and proximity labeling approaches. Integrate computational predictions with experimental validation. Apply metabolomic and proteomic profiling of knockout strains to identify affected pathways.

  • Physiological relevance assessment:

    • Challenge: Determining the biological importance of YJL202C under standard laboratory conditions.

    • Solution: Test phenotypes under diverse environmental stresses. Implement synthetic genetic interaction mapping to identify functional relationships. Create sensitized genetic backgrounds where YJL202C function becomes essential.

  • Structural characterization obstacles:

    • Challenge: Structural studies often require stable, homogeneous protein samples.

    • Solution: Employ predicted structural models from AlphaFold as starting points. Consider structure determination of individual domains if the full-length protein proves challenging. Use hydrogen-deuterium exchange mass spectrometry to identify stable regions for crystallization.

The methodological approaches outlined throughout this FAQ document provide a comprehensive framework for addressing these challenges and advancing our understanding of YJL202C's biological role in Saccharomyces cerevisiae.

What future research directions should be prioritized to fully characterize YJL202C function in Saccharomyces cerevisiae?

Future research on YJL202C should prioritize the following directions:

  • Systematic functional genomics integration:

    • Combine CRISPR-mediated gene editing with high-throughput phenotypic assays

    • Implement bar-coded deletion libraries for competitive growth assays

    • Apply Perturb-seq approaches to analyze single-cell transcriptional responses

  • Evolutionary functional inference:

    • Perform deep comparative analysis across fungi with varying evolutionary distances

    • Implement ancestral sequence reconstruction to trace functional evolution

    • Test cross-species complementation to identify conserved and divergent functions

  • Structural biology with functional validation:

    • Determine high-resolution structure and identify potential active sites

    • Generate structure-guided mutations to test functional hypotheses

    • Characterize protein dynamics through HDX-MS and NMR

  • Systems-level integration:

    • Position YJL202C within the context of yeast protein-protein interaction networks

    • Develop mathematical models incorporating YJL202C function in relevant pathways

    • Apply multi-omics approaches to understand systemic effects of YJL202C perturbation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.