Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR018W (YJR018W) is a bioengineered protein derived from the Saccharomyces cerevisiae genome. It is classified as a "putative uncharacterized protein" due to limited functional data, though genomic studies suggest potential roles in cellular processes like vacuolar protein sorting . The recombinant form is typically expressed in E. coli with an N-terminal His-tag for purification and structural studies .
The protein spans 120 amino acids (1–120) with the sequence:
MFSDLCDAGLLESLCLMRMCRHLTRTGWSLKCLCSWSLLVPSGSSHCECFVSGLKKYSLFLDLLYLTVHGVGSPVLDATSDGIGASLWCRSRLCVGISTTMIIQVLFLLRSKGKRYDTRS .
YJR018W was identified in a genome-wide screen for vacuolar protein sorting (VPS) mutants . Deletion strains exhibited carboxypeptidase Y (CPY) missorting, implicating YJR018W in:
CPY pathway: Transport of soluble hydrolases to the vacuole via late-Golgi and prevacuolar compartments .
Actin cytoskeleton interaction: Some mutants showed cytoskeletal defects at 30°C, though YJR018W’s role remains unconfirmed .
Vacuole biogenesis: May regulate trafficking or membrane dynamics in the CPY pathway .
Protein secretion: Potential involvement in α-factor processing or membrane protein cycling .
Structural studies: His-tag enables crystallization or NMR analysis .
Interaction assays: Potential co-IP or pull-down experiments to identify binding partners .
Functional ambiguity: No direct evidence links YJR018W to specific biochemical activities .
Expression profile: No detectable expression under standard conditions (SGD data) .
Conservation: Limited homology to characterized proteins in other species .
YJR018W lacks annotated domains (InterProScan analysis) , distinguishing it from:
UPF proteins: Uncharacterized proteins with conserved folds (e.g., YHL050W-A) .
VPS-associated proteins: Like Vps64p or Vps67p, which interact with the actin cytoskeleton .
Functional validation: CRISPR-based knockout/rescue experiments in S. cerevisiae.
Structural elucidation: X-ray crystallography or cryo-EM of the recombinant protein.
Interactome mapping: High-throughput screens to identify binding partners.
Several complementary approaches are employed to study uncharacterized proteins like YJR018W:
| Method | Application | Advantages | Limitations |
|---|---|---|---|
| Genetic screens | Identify phenotypes associated with gene deletion | Genome-wide analysis possible | May miss subtle phenotypes |
| Direct-repeat recombination assays | Measure recombination rates in deletion strains | Quantifies specific DNA repair processes | Limited to specific pathway |
| Antibody-based detection | Protein localization and expression analysis | Direct visualization of protein | Requires specific antibodies |
| Recombinant protein expression | Biochemical and structural studies | Provides material for in vitro studies | May not reflect native properties |
For YJR018W specifically, researchers have employed genetic screening approaches using the YKO (yeast knockout) collection to identify phenotypes associated with its deletion . Antibodies against YJR018W have been developed for applications including ELISA and Western blotting, enabling detection of the native protein . Recombinant expression systems using E. coli with His-tags have been established to produce the protein for biochemical studies .
Recombinant YJR018W is typically produced in E. coli expression systems with affinity tags to facilitate purification. The most common approach involves:
Expression system: E. coli bacterial expression with full-length YJR018W (1-120 amino acids)
Affinity tag: Histidine tag (His-tag) for metal affinity chromatography
Storage buffer: Optimized buffer containing 50% glycerol and Tris-based components
Storage conditions: -20°C for short-term; -80°C for extended storage
The purification protocol typically follows this workflow:
Bacterial cell lysis under native or denaturing conditions
Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins
Washing steps to remove non-specifically bound proteins
Elution with imidazole buffer
Buffer exchange to remove imidazole and stabilize the protein
Quality control by SDS-PAGE and/or Western blotting
For applications requiring tag removal, specific protease cleavage sites can be engineered between the tag and the protein sequence, followed by a second affinity step to separate the cleaved tag.
While YJR018W remains largely uncharacterized, genomic and functional screens have provided some insights:
Recombination pathways: YJR018W appears in genome-wide screens for genes affecting spontaneous direct-repeat recombination . The deletion of YJR018W has been shown to impact recombination rates, suggesting a potential role in DNA metabolism or genome stability .
Quantitative assessment: In recombination rate studies, YJR018W deletion showed a recombination rate of 1.94E-05 with a p-value of 2.52E-03 compared to wild-type strains, indicating statistical significance .
Functional context: YJR018W is listed alongside known recombination factors like THP2 in genetic screen results, providing context for its potential functional space .
Phenotypic classification: The YZ score (Yeast Z-curve score, a measure of protein-coding potential) has been calculated for YJR018W, supporting its status as a true protein-coding gene rather than a spurious open reading frame .
These findings suggest YJR018W may function in pathways related to genome maintenance, though the precise biochemical mechanism remains to be elucidated.
To begin characterizing YJR018W function, a systematic approach combining multiple techniques is recommended:
Phenotypic analysis of deletion strain:
Growth rate measurements under various conditions (temperature, pH, osmotic stress)
Sensitivity to DNA-damaging agents (UV, MMS, hydroxyurea)
Cell cycle analysis using flow cytometry
Microscopic examination for morphological abnormalities
Protein localization:
Epitope tagging (GFP, FLAG, HA) of YJR018W at the genomic locus
Fluorescence microscopy to determine subcellular localization
Co-localization with known cellular markers
Changes in localization under stress conditions
Expression profiling:
RT-qPCR to measure YJR018W expression under various conditions
Western blotting to determine protein levels and potential post-translational modifications
Analysis of expression changes in response to cell cycle progression or stress
Genetic interaction mapping:
Synthetic genetic array (SGA) analysis to identify genetic interactions
Construction of double mutants with genes in suspected pathways
Suppressor screens to identify genes that rescue deletion phenotypes
This systematic approach provides a foundation for understanding YJR018W function before proceeding to more specialized or advanced techniques.
When investigating uncharacterized proteins like YJR018W, a carefully structured experimental design is essential. Based on established research methodologies, the following approach is recommended:
Define variables and hypotheses:
Apply factorial experimental designs:
Implement complementary approaches:
Statistical analysis planning:
One particularly effective design for YJR018W could be the patch and replica-plating method combined with high-throughput replica-pinning methodology as used in recombination screens . This approach allows for:
Semi-quantitative estimation of recombination rates
Parallel analysis of multiple independent colonies
Comparison with known recombination mutants as benchmarks
Validation of hits through independent methodologies
When designing experiments, researchers should include proper controls such as wild-type strains and known mutants with established phenotypes (e.g., elg1∆ as a positive control for recombination phenotypes) .
Genetic screens provide powerful approaches for understanding the function of uncharacterized proteins like YJR018W. Based on successful applications in the literature, researchers should consider:
Synthetic Genetic Array (SGA) methodology:
The SGA workflow for YJR018W typically follows this process:
Creation of a query strain (YJR018W∆) compatible with SGA methodology
Mating with ordered array of deletion mutants
Selection of diploids and subsequent sporulation
Selection of haploid double mutants using appropriate markers
Phenotypic analysis of resulting double mutant collection
Recombination assays using reporter constructs:
High-throughput phenotypic screens:
Expose YJR018W∆ to libraries of compounds or environmental stresses
Identify conditions that differentially affect mutant vs. wild-type
Cluster phenotypic signatures with known mutants to infer pathway relationships
Suppressor screens:
Identify mutations or genes that suppress YJR018W∆ phenotypes
Use high-copy plasmid libraries or transposon mutagenesis
Sequence suppressors to identify functional relationships
The effectiveness of these approaches has been demonstrated in published screens where YJR018W was identified alongside genes of known function, suggesting involvement in recombination pathways with a recombination rate of 1.94E-05 (p-value: 2.52E-03) .
Given the limited experimental characterization of YJR018W, computational methods provide valuable insights into potential functions. Several bioinformatic approaches are particularly useful:
Sequence-based predictions:
Profile Hidden Markov Models (HMMs) to identify distant homology
Secondary structure prediction to identify structural features
Disorder prediction to identify flexible regions
Motif scanning for functional site identification
Z-curve analysis:
The Z-curve approach transforms DNA sequence information into a three-dimensional curve where:
xn represents purine vs. pyrimidine distribution
yn represents amino vs. keto base distribution
Gene co-expression analysis:
Identify genes with similar expression patterns across conditions
Cluster analysis to find genes with coordinated regulation
Integration with transcription factor binding site data
Protein-protein interaction prediction:
Computational prediction of interaction partners
Integration with experimental interaction data
Network analysis to identify functional modules
Gene Ontology (GO) term enrichment:
Analysis of GO terms associated with genetic interactors
Identification of enriched biological processes, molecular functions, or cellular components
In the case of YJR018W, bioinformatic analyses indicate a potential role in genome maintenance pathways, particularly in processes related to recombination or DNA metabolism, consistent with experimental genetic screen results .
When faced with contradictory data about YJR018W function, a systematic approach to reconciling discrepancies is essential:
Reassess experimental conditions:
Analyze methodological differences:
Direct vs. indirect measurement approaches
Sensitivity and specificity of different assays
Time-scale differences (acute vs. chronic effects)
Single-cell vs. population-level measurements
Replication and validation strategies:
Statistical reassessment:
Reanalyze data using appropriate statistical methods
Consider issues of statistical power and sample size
Evaluate effect sizes rather than just p-values
Implement meta-analysis techniques when multiple datasets exist
Reconciliation through model refinement:
For example, if studies show conflicting results regarding YJR018W's impact on recombination rates, researchers should consider factors such as different recombination substrates, growth conditions, or genetic interactions that might explain context-dependent effects.
Understanding YJR018W's protein interaction network is crucial for functional characterization. The following cutting-edge approaches are recommended:
Affinity purification coupled with mass spectrometry (AP-MS):
Proximity-based labeling methods:
BioID or TurboID fusion to YJR018W for in vivo proximity labeling
APEX2 for spatially and temporally resolved interaction mapping
Identification of transient or weak interactions missed by conventional methods
Yeast two-hybrid (Y2H) screening:
Traditional Y2H against ordered arrays or cDNA libraries
Split-ubiquitin Y2H for membrane-associated interactions
Cytosolic Y2H systems for studying protein fragments
Fluorescence-based interaction assays:
Förster Resonance Energy Transfer (FRET)
Bimolecular Fluorescence Complementation (BiFC)
Fluorescence Correlation Spectroscopy (FCS)
Single-molecule co-localization techniques
Protein complementation assays:
Split-luciferase, split-GFP, or split-DHFR systems
In vivo validation of interactions identified by other methods
Real-time monitoring of dynamic interactions
For YJR018W specifically, researchers should consider utilizing cell map resources (e.g., http://thecellmap.org/) to analyze interaction networks . Previous interaction studies have detected YJR018W associations using techniques including yeast two-hybrid, co-immunoprecipitation (co-IP), and pull-down assays . These methods can be leveraged to build a comprehensive protein-protein interaction network for YJR018W, providing insights into its functional role within cellular pathways.