Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR018W (YJR018W)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR018W (YJR018W) is a bioengineered protein derived from the Saccharomyces cerevisiae genome. It is classified as a "putative uncharacterized protein" due to limited functional data, though genomic studies suggest potential roles in cellular processes like vacuolar protein sorting . The recombinant form is typically expressed in E. coli with an N-terminal His-tag for purification and structural studies .

Primary Sequence

The protein spans 120 amino acids (1–120) with the sequence:
MFSDLCDAGLLESLCLMRMCRHLTRTGWSLKCLCSWSLLVPSGSSHCECFVSGLKKYSLFLDLLYLTVHGVGSPVLDATSDGIGASLWCRSRLCVGISTTMIIQVLFLLRSKGKRYDTRS .

Key Features

ParameterDetail
Length120 amino acids
Predicted MWNot explicitly stated; inferred from sequence length (~13.7 kDa)
TagN-terminal His-tag (for affinity purification)
Expression HostE. coli
Purity>90% by SDS-PAGE

Genomic Insights

YJR018W was identified in a genome-wide screen for vacuolar protein sorting (VPS) mutants . Deletion strains exhibited carboxypeptidase Y (CPY) missorting, implicating YJR018W in:

  • CPY pathway: Transport of soluble hydrolases to the vacuole via late-Golgi and prevacuolar compartments .

  • Actin cytoskeleton interaction: Some mutants showed cytoskeletal defects at 30°C, though YJR018W’s role remains unconfirmed .

Functional Hypotheses

  • Vacuole biogenesis: May regulate trafficking or membrane dynamics in the CPY pathway .

  • Protein secretion: Potential involvement in α-factor processing or membrane protein cycling .

Recombinant Production and Handling

ParameterDetail
FormLyophilized powder
Storage-20°C/-80°C; avoid freeze-thaw cycles
ReconstitutionDeionized water (0.1–1.0 mg/mL); add 5–50% glycerol for stability
SupplierCreative BioMart (Cat. RFL27992SF)

Experimental Use Cases

  • Structural studies: His-tag enables crystallization or NMR analysis .

  • Interaction assays: Potential co-IP or pull-down experiments to identify binding partners .

Knowledge Gaps and Challenges

  • Functional ambiguity: No direct evidence links YJR018W to specific biochemical activities .

  • Expression profile: No detectable expression under standard conditions (SGD data) .

  • Conservation: Limited homology to characterized proteins in other species .

Domain Architecture

YJR018W lacks annotated domains (InterProScan analysis) , distinguishing it from:

  • UPF proteins: Uncharacterized proteins with conserved folds (e.g., YHL050W-A) .

  • VPS-associated proteins: Like Vps64p or Vps67p, which interact with the actin cytoskeleton .

Future Research Directions

  1. Functional validation: CRISPR-based knockout/rescue experiments in S. cerevisiae.

  2. Structural elucidation: X-ray crystallography or cryo-EM of the recombinant protein.

  3. Interactome mapping: High-throughput screens to identify binding partners.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
YJR018W; J1454; YJR83.14; Putative uncharacterized protein YJR018W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJR018W
Target Protein Sequence
MFSDLCDAGLLESLCLMRMCRHLTRTGWSLKCLCSWSLLVPSGSSHCECFVSGLKKYSLF LDLLYLTVHGVGSPVLDATSDGIGASLWCRSRLCVGISTTMIIQVLFLLRSKGKRYDTRS
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What experimental methods are commonly used to study YJR018W?

Several complementary approaches are employed to study uncharacterized proteins like YJR018W:

MethodApplicationAdvantagesLimitations
Genetic screensIdentify phenotypes associated with gene deletionGenome-wide analysis possibleMay miss subtle phenotypes
Direct-repeat recombination assaysMeasure recombination rates in deletion strainsQuantifies specific DNA repair processesLimited to specific pathway
Antibody-based detectionProtein localization and expression analysisDirect visualization of proteinRequires specific antibodies
Recombinant protein expressionBiochemical and structural studiesProvides material for in vitro studiesMay not reflect native properties

For YJR018W specifically, researchers have employed genetic screening approaches using the YKO (yeast knockout) collection to identify phenotypes associated with its deletion . Antibodies against YJR018W have been developed for applications including ELISA and Western blotting, enabling detection of the native protein . Recombinant expression systems using E. coli with His-tags have been established to produce the protein for biochemical studies .

How is recombinant YJR018W typically produced and purified?

Recombinant YJR018W is typically produced in E. coli expression systems with affinity tags to facilitate purification. The most common approach involves:

  • Expression system: E. coli bacterial expression with full-length YJR018W (1-120 amino acids)

  • Affinity tag: Histidine tag (His-tag) for metal affinity chromatography

  • Storage buffer: Optimized buffer containing 50% glycerol and Tris-based components

  • Storage conditions: -20°C for short-term; -80°C for extended storage

The purification protocol typically follows this workflow:

  • Bacterial cell lysis under native or denaturing conditions

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins

  • Washing steps to remove non-specifically bound proteins

  • Elution with imidazole buffer

  • Buffer exchange to remove imidazole and stabilize the protein

  • Quality control by SDS-PAGE and/or Western blotting

For applications requiring tag removal, specific protease cleavage sites can be engineered between the tag and the protein sequence, followed by a second affinity step to separate the cleaved tag.

What is known about YJR018W's potential function based on genomic studies?

While YJR018W remains largely uncharacterized, genomic and functional screens have provided some insights:

  • Recombination pathways: YJR018W appears in genome-wide screens for genes affecting spontaneous direct-repeat recombination . The deletion of YJR018W has been shown to impact recombination rates, suggesting a potential role in DNA metabolism or genome stability .

  • Quantitative assessment: In recombination rate studies, YJR018W deletion showed a recombination rate of 1.94E-05 with a p-value of 2.52E-03 compared to wild-type strains, indicating statistical significance .

  • Functional context: YJR018W is listed alongside known recombination factors like THP2 in genetic screen results, providing context for its potential functional space .

  • Phenotypic classification: The YZ score (Yeast Z-curve score, a measure of protein-coding potential) has been calculated for YJR018W, supporting its status as a true protein-coding gene rather than a spurious open reading frame .

These findings suggest YJR018W may function in pathways related to genome maintenance, though the precise biochemical mechanism remains to be elucidated.

How can a researcher design a basic functional characterization study for YJR018W?

To begin characterizing YJR018W function, a systematic approach combining multiple techniques is recommended:

  • Phenotypic analysis of deletion strain:

    • Growth rate measurements under various conditions (temperature, pH, osmotic stress)

    • Sensitivity to DNA-damaging agents (UV, MMS, hydroxyurea)

    • Cell cycle analysis using flow cytometry

    • Microscopic examination for morphological abnormalities

  • Protein localization:

    • Epitope tagging (GFP, FLAG, HA) of YJR018W at the genomic locus

    • Fluorescence microscopy to determine subcellular localization

    • Co-localization with known cellular markers

    • Changes in localization under stress conditions

  • Expression profiling:

    • RT-qPCR to measure YJR018W expression under various conditions

    • Western blotting to determine protein levels and potential post-translational modifications

    • Analysis of expression changes in response to cell cycle progression or stress

  • Genetic interaction mapping:

    • Synthetic genetic array (SGA) analysis to identify genetic interactions

    • Construction of double mutants with genes in suspected pathways

    • Suppressor screens to identify genes that rescue deletion phenotypes

This systematic approach provides a foundation for understanding YJR018W function before proceeding to more specialized or advanced techniques.

What experimental designs are most effective for studying uncharacterized proteins like YJR018W?

When investigating uncharacterized proteins like YJR018W, a carefully structured experimental design is essential. Based on established research methodologies, the following approach is recommended:

  • Define variables and hypotheses:

    • Independent variables: Genetic background (WT vs. YJR018W∆), environmental conditions

    • Dependent variables: Growth rates, survival, recombination rates, protein interactions

    • Formulate specific, testable hypotheses based on preliminary data

  • Apply factorial experimental designs:

    • Test multiple factors simultaneously (e.g., gene deletion × stress condition × genetic background)

    • Include appropriate controls (wild-type, known mutants in related pathways)

    • Ensure replication within each experimental condition

  • Implement complementary approaches:

    • High-throughput screens to generate hypotheses

    • Focused, mechanistic studies to validate findings

    • Both in vivo and in vitro approaches to triangulate function

  • Statistical analysis planning:

    • Determine appropriate statistical tests before experimentation

    • Calculate required sample sizes for adequate statistical power

    • Plan for multiple testing correction in high-throughput experiments

One particularly effective design for YJR018W could be the patch and replica-plating method combined with high-throughput replica-pinning methodology as used in recombination screens . This approach allows for:

  • Semi-quantitative estimation of recombination rates

  • Parallel analysis of multiple independent colonies

  • Comparison with known recombination mutants as benchmarks

  • Validation of hits through independent methodologies

When designing experiments, researchers should include proper controls such as wild-type strains and known mutants with established phenotypes (e.g., elg1∆ as a positive control for recombination phenotypes) .

How can genetic screens be used to elucidate the function of YJR018W?

Genetic screens provide powerful approaches for understanding the function of uncharacterized proteins like YJR018W. Based on successful applications in the literature, researchers should consider:

  • Synthetic Genetic Array (SGA) methodology:

    • Cross YJR018W deletion strain with the entire yeast knockout collection

    • Use SGA selection media to isolate double mutants

    • Identify synthetic lethal or synthetic sick interactions

    • Map genetic interaction networks to infer function

The SGA workflow for YJR018W typically follows this process:

  • Creation of a query strain (YJR018W∆) compatible with SGA methodology

  • Mating with ordered array of deletion mutants

  • Selection of diploids and subsequent sporulation

  • Selection of haploid double mutants using appropriate markers

  • Phenotypic analysis of resulting double mutant collection

  • Recombination assays using reporter constructs:

    • Introduce recombination reporters (e.g., leu2∆EcoRI-URA3-leu2∆BstEII) into YJR018W∆

    • Measure recombination rates through fluctuation analysis

    • Compare with known recombination mutants

    • Classify based on epistatic relationships with characterized genes

  • High-throughput phenotypic screens:

    • Expose YJR018W∆ to libraries of compounds or environmental stresses

    • Identify conditions that differentially affect mutant vs. wild-type

    • Cluster phenotypic signatures with known mutants to infer pathway relationships

  • Suppressor screens:

    • Identify mutations or genes that suppress YJR018W∆ phenotypes

    • Use high-copy plasmid libraries or transposon mutagenesis

    • Sequence suppressors to identify functional relationships

The effectiveness of these approaches has been demonstrated in published screens where YJR018W was identified alongside genes of known function, suggesting involvement in recombination pathways with a recombination rate of 1.94E-05 (p-value: 2.52E-03) .

What bioinformatic approaches can predict the function of YJR018W?

Given the limited experimental characterization of YJR018W, computational methods provide valuable insights into potential functions. Several bioinformatic approaches are particularly useful:

  • Sequence-based predictions:

    • Profile Hidden Markov Models (HMMs) to identify distant homology

    • Secondary structure prediction to identify structural features

    • Disorder prediction to identify flexible regions

    • Motif scanning for functional site identification

  • Z-curve analysis:

    • The Z-curve method has been successfully applied to the yeast genome with >95% accuracy

    • For YJR018W, the YZ score can assess protein-coding potential

    • Z-curve components (xn, yn, zn) provide insights into purine/pyrimidine, amino/keto, and strong/weak hydrogen bond distributions

The Z-curve approach transforms DNA sequence information into a three-dimensional curve where:

  • xn represents purine vs. pyrimidine distribution

  • yn represents amino vs. keto base distribution

  • zn represents strong vs. weak hydrogen bond distribution

  • Gene co-expression analysis:

    • Identify genes with similar expression patterns across conditions

    • Cluster analysis to find genes with coordinated regulation

    • Integration with transcription factor binding site data

  • Protein-protein interaction prediction:

    • Computational prediction of interaction partners

    • Integration with experimental interaction data

    • Network analysis to identify functional modules

  • Gene Ontology (GO) term enrichment:

    • Analysis of GO terms associated with genetic interactors

    • Identification of enriched biological processes, molecular functions, or cellular components

In the case of YJR018W, bioinformatic analyses indicate a potential role in genome maintenance pathways, particularly in processes related to recombination or DNA metabolism, consistent with experimental genetic screen results .

How do researchers handle contradictory data regarding YJR018W function?

When faced with contradictory data about YJR018W function, a systematic approach to reconciling discrepancies is essential:

  • Reassess experimental conditions:

    • Compare exact experimental protocols (media, temperature, strain backgrounds)

    • Evaluate differences in genetic backgrounds (lab strains can accumulate mutations)

    • Consider environmental variables that might affect outcomes

    • Examine timing and developmental stages of experiments

  • Analyze methodological differences:

    • Direct vs. indirect measurement approaches

    • Sensitivity and specificity of different assays

    • Time-scale differences (acute vs. chronic effects)

    • Single-cell vs. population-level measurements

  • Replication and validation strategies:

    • Repeat key experiments using identical protocols

    • Use orthogonal methods to test the same hypothesis

    • Perform dose-response or time-course studies

    • Include additional controls to test alternative explanations

  • Statistical reassessment:

    • Reanalyze data using appropriate statistical methods

    • Consider issues of statistical power and sample size

    • Evaluate effect sizes rather than just p-values

    • Implement meta-analysis techniques when multiple datasets exist

  • Reconciliation through model refinement:

    • Develop more nuanced models that account for context-dependency

    • Consider condition-specific or tissue-specific effects

    • Incorporate temporal dynamics and feedback mechanisms

    • Use systems biology approaches to integrate contradictory data points

For example, if studies show conflicting results regarding YJR018W's impact on recombination rates, researchers should consider factors such as different recombination substrates, growth conditions, or genetic interactions that might explain context-dependent effects.

What are the state-of-the-art techniques for characterizing protein-protein interactions involving YJR018W?

Understanding YJR018W's protein interaction network is crucial for functional characterization. The following cutting-edge approaches are recommended:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Tag YJR018W with epitopes (FLAG, HA, TAP)

    • Perform immunoprecipitation under native conditions

    • Identify co-purifying proteins by mass spectrometry

    • Differentiate between direct and indirect interactions through stringency controls

    • Quantitative proteomics to measure interaction strengths

  • Proximity-based labeling methods:

    • BioID or TurboID fusion to YJR018W for in vivo proximity labeling

    • APEX2 for spatially and temporally resolved interaction mapping

    • Identification of transient or weak interactions missed by conventional methods

  • Yeast two-hybrid (Y2H) screening:

    • Traditional Y2H against ordered arrays or cDNA libraries

    • Split-ubiquitin Y2H for membrane-associated interactions

    • Cytosolic Y2H systems for studying protein fragments

  • Fluorescence-based interaction assays:

    • Förster Resonance Energy Transfer (FRET)

    • Bimolecular Fluorescence Complementation (BiFC)

    • Fluorescence Correlation Spectroscopy (FCS)

    • Single-molecule co-localization techniques

  • Protein complementation assays:

    • Split-luciferase, split-GFP, or split-DHFR systems

    • In vivo validation of interactions identified by other methods

    • Real-time monitoring of dynamic interactions

For YJR018W specifically, researchers should consider utilizing cell map resources (e.g., http://thecellmap.org/) to analyze interaction networks . Previous interaction studies have detected YJR018W associations using techniques including yeast two-hybrid, co-immunoprecipitation (co-IP), and pull-down assays . These methods can be leveraged to build a comprehensive protein-protein interaction network for YJR018W, providing insights into its functional role within cellular pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.