Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR038C (YJR038C)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR038C (YJR038C) refers to a protein produced using recombinant DNA technology in Saccharomyces cerevisiae, commonly known as Baker's yeast . The protein, denoted as YJR038C, is a putative uncharacterized protein, meaning its function is not yet fully understood .

Production and Purity

Recombinant YJR038C is produced in various hosts, including E. coli, Yeast, Baculovirus, or Mammalian cells . The purity of the recombinant protein is typically ≥ 85%, as determined by SDS-PAGE .

Synonyms and Identifiers

FeatureDescription
Gene NameYJR038C
Other NamesPutative uncharacterized protein YJR038C
Host OrganismSaccharomyces cerevisiae

Applications

YJR038C has potential applications in research, particularly in understanding protein-protein interactions and complex formation within Saccharomyces cerevisiae . Additionally, Saccharomyces cerevisiae itself is utilized in various applications, such as:

  • Basic Research: As a valuable tool for studying eukaryotic organisms .

  • Industrial Applications: For expressing heterologous proteins and stimulating immune responses .

Protein Complex Studies

Saccharomyces cerevisiae is used to study protein complexes, with two main catalogs, YHTP2008 and CYC2008, detailing these complexes . The CYC2008 catalog, for example, lists 408 heteromeric yeast protein complexes, backed by small-scale experiments . These catalogs aid in understanding protein interactions within the cell .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YJR038C; J1612; Putative uncharacterized protein YJR038C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJR038C
Target Protein Sequence
MTTNSRLCPSSPSSSLIKHLTTSGGPSTSLTIMLSVIAIRILPAGMRNWIRQALGSLLFA SFLLLSSFHYPITLTLVPVYHESLVKPTSASFGGIRLSQLTMIMERRATPTCQDPSLTEV
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.