Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YKL044W (YKL044W)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

Gene Name: YKL044W
Synonyms: YKL257, MMO1 (Mitochondrial Mini-ORF 1)
UniProt ID: P36092
Molecular Weight: 12.4 kDa (theoretical)
Isoelectric Point (pI): 9.5 (predicted)

PropertyValueSource
Amino Acid Length106 residues
Subcellular LocalizationMitochondria
Structural FeaturesSingle-pass membrane protein

Recombinant Production

The protein is expressed in heterologous systems with the following specifications:

Expression Systems

  • Hosts: E. coli, Yeast, Baculovirus, Mammalian Cells

  • Tag: N-terminal His-tag (optional)

  • Purity: ≥85% (SDS-PAGE)

Functional Annotations

  • Genetic Interactions: Exhibits synthetic lethality with ASI2 (SGA score: -0.2075) .

  • Predicted Partners: YCL007C (putative protein), MEO1 (ER-localized protein) .

  • Role: Non-essential for growth but linked to mitochondrial integrity in genome-deleted strains .

Research Applications

ApplicationDescriptionSource
ELISA/Western BlotDetected using anti-YKL044W polyclonal antibodies
Localization StudiesMitochondrial targeting confirmed via GFP/mCherry fusions
Structural BiologyUsed in 3D modeling (ModBase ID: P36092)

Key Research Findings

  1. Mitochondrial Association: SWAP-Tag and subcellular fractionation studies confirmed mitochondrial localization, leading to its designation as MMO1 .

  2. Genetic Network: Negative genetic interactions with ASI2 suggest involvement in stress response pathways .

  3. Conservation: Homologs exist in other Saccharomyces species but lack functional annotations .

Limitations and Future Directions

  • Functional Uncertainty: No enzymatic or regulatory activity has been experimentally validated.

  • Research Gaps:

    • Interaction studies with mitochondrial complexes.

    • Phenotypic analysis under oxidative stress conditions.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YKL044W; YKL257; Uncharacterized protein YKL044W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YKL044W
Target Protein Sequence
MGYVIMTFSSARMSERRARIIYIWMHLSAYKINFPFVQFPTFFSLFRLQKKAAILIKNPS PFFLFFLFPYRKNSTARTIHQINQAVALVLLCVSHHLTYLPSVPSL
Uniprot No.

Target Background

Database Links

KEGG: sce:YKL044W

STRING: 4932.YKL044W

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YKL044W and where is it located in the Saccharomyces cerevisiae genome?

YKL044W is a small open reading frame (ORF) located within the untranslated region (UTR) of the PHD1 gene in Saccharomyces cerevisiae. Evidence for its translation comes from ribosomal profiling experiments, confirming that this putative protein is indeed expressed despite its unusual genomic location . The protein consists of 106 amino acids in its full-length form . As its name suggests ("putative uncharacterized protein"), YKL044W's precise biological function remains largely unknown, making it an interesting target for fundamental research in yeast biology.

How was YKL044W initially identified and what evidence exists for its expression?

YKL044W was identified through computational genome annotation of S. cerevisiae, but confirmation of its expression came primarily through ribosomal profiling experiments. Brar et al. (2012) provided experimental evidence that this region is actively translated despite being located within the UTR of another gene . This discovery highlights the complexity of the yeast genome, where even regions traditionally considered non-coding may produce functional proteins. The detection of this protein underscores the importance of experimental verification of computationally predicted ORFs, particularly for small genes that might be overlooked in conventional analyses.

What is known about the structural characteristics of YKL044W protein?

Limited structural information is available for YKL044W, but we do know it's a relatively small protein of 106 amino acids . No crystal structure has been reported in the literature provided. For researchers interested in structural studies, recombinant expression systems are available that produce His-tagged versions of the full-length protein (1-106 amino acids) in E. coli expression systems . These recombinant versions would facilitate purification for subsequent structural analyses using techniques such as X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy.

What are the recommended protocols for recombinant expression and purification of YKL044W?

For recombinant expression of YKL044W, E. coli-based expression systems have been successfully employed to produce His-tagged versions of the full-length protein . A typical protocol would involve:

  • Cloning the YKL044W coding sequence into an appropriate expression vector with a His-tag (either N- or C-terminal)

  • Transforming the construct into an E. coli expression strain (BL21(DE3) or similar)

  • Inducing protein expression with IPTG at optimal temperature (often 18-25°C for better solubility)

  • Lysing cells and purifying the protein using nickel affinity chromatography

  • Further purification via size exclusion chromatography if needed

For enhanced purity, researchers should consider optimizing induction conditions (temperature, IPTG concentration, duration) and incorporating additional purification steps such as ion exchange chromatography depending on the protein's theoretical isoelectric point.

How can researchers generate YKL044W deletion strains in S. cerevisiae for functional studies?

To generate YKL044W deletion strains in S. cerevisiae, researchers typically employ homologous recombination-based gene replacement strategies. The process involves:

  • Designing PCR primers with 40-50bp homology to the flanking regions of YKL044W

  • Amplifying a selectable marker cassette (such as KanMX conferring resistance to G418)

  • Transforming the PCR product into yeast cells

  • Selecting transformants on appropriate media containing the selective agent

  • Confirming gene deletion by PCR verification and/or sequencing

Studies have successfully created YKL044W deletion strains for metabolic profiling studies . When creating such deletion strains, researchers should be cautious about potential effects on the overlapping PHD1 gene, as YKL044W is located within its UTR. Appropriate controls and careful design of deletion constructs are essential to ensure that observed phenotypes are specifically due to YKL044W deletion rather than disruption of PHD1 regulation.

What methods are effective for detecting and quantifying YKL044W expression levels in yeast cells?

For detecting and quantifying YKL044W expression, researchers can employ several complementary approaches:

  • RT-qPCR: Design primers specific to the YKL044W sequence to quantify mRNA levels

  • Ribosome profiling: As used by Brar et al. (2012), this technique can confirm active translation

  • Western blotting: Using antibodies against epitope-tagged versions of YKL044W

  • Mass spectrometry: For detection and quantification of the native protein

For studying the protein in its native context, researchers often create genomically-tagged versions (with GFP, HA, or TAP tags) through homologous recombination. When working with YKL044W, special consideration should be given to its location within the PHD1 UTR, as tagging might affect the expression or function of both genes. Appropriate controls and validation experiments are essential to ensure that the detection method does not interfere with the protein's native expression pattern or function.

What metabolic changes are observed in YKL044W deletion strains?

Metabolic profiling of YKL044W deletion strains reveals significant alterations in amino acid homeostasis. According to the Metabolic Gene Card data, the deletion strain exhibits distinct changes in free amino acid profiles when grown in minimum synthetic medium . Statistical analyses using both multivariate (χ² test) and univariate (Z-test) methods identified significant alterations compared to wild-type strains, with the YKL044W deletion strain being among 1519 strains showing altered amino acid profiles .

The specific pattern of amino acid changes can provide insights into the metabolic pathways potentially influenced by YKL044W. Researchers investigating this protein should consider performing comprehensive metabolomics analyses beyond amino acids to fully characterize the metabolic impact of YKL044W deletion. Such studies would ideally include measurements of central carbon metabolism intermediates, lipids, and other small molecules to build a complete picture of YKL044W's role in cellular metabolism.

Are there known genetic interactions between YKL044W and other yeast genes?

While the provided information doesn't explicitly detail genetic interactions for YKL044W, methodologies for identifying such interactions have been described. High-copy suppressor screens, similar to those performed for ELG1 and SRS2 , could be applied to identify genes that, when overexpressed, can suppress phenotypes of YKL044W deletion.

To comprehensively map genetic interactions, researchers could employ:

  • Synthetic genetic array (SGA) analysis - systematically creating double mutants with all viable yeast deletion strains

  • Dosage suppression screens - testing for genes that suppress YKL044W deletion phenotypes when overexpressed

  • Dosage lethality screens - identifying genes whose overexpression is toxic in a YKL044W deletion background

The relationship between YKL044W and PHD1 warrants special attention since YKL044W is located within the UTR of PHD1. This genomic arrangement suggests possible functional relationships or regulatory interactions between these two genes that should be experimentally investigated.

What cellular localization patterns does YKL044W exhibit and how does this inform its function?

The provided information doesn't explicitly mention the cellular localization of YKL044W. To determine its localization, researchers would typically use one of the following approaches:

  • Fluorescent protein tagging (GFP, mCherry, etc.) of the endogenous gene

  • Immunofluorescence using antibodies against epitope-tagged versions

  • Biochemical fractionation followed by Western blotting

  • Predictive bioinformatics tools to identify potential localization signals

The localization pattern would provide valuable clues about function. For example, nuclear localization might suggest involvement in transcription or DNA metabolism, whereas cytoplasmic localization might indicate roles in metabolism or protein synthesis. For proteins like YKL044W that overlap with other genes, careful experimental design is crucial to ensure that tagging doesn't disrupt the expression or function of either gene.

How can YKL044W be utilized in studies of gene expression regulation, particularly for genes located within UTRs?

YKL044W represents an interesting case of a protein-coding sequence located within the UTR of another gene (PHD1), making it valuable for studying complex gene organization and expression regulation . Researchers can use this system to investigate:

  • Translational regulation mechanisms: How ribosomes select alternative ORFs within the same transcript

  • Regulatory relationships between overlapping genes: Whether expression of YKL044W affects PHD1 function and vice versa

  • Evolution of nested genes: Comparative genomics across yeast species to understand the evolutionary conservation of this arrangement

Experimental approaches might include:

  • Mutational analysis of regulatory elements affecting both genes

  • Reporter assays to monitor expression from the shared region

  • CRISPR interference techniques to selectively repress transcription at specific sites

  • Ribosome profiling to quantify translation efficiency at both ORFs

These studies could provide insights into the prevalence and importance of overlapping coding sequences in compact genomes like that of S. cerevisiae.

What insights can YKL044W deletion provide for understanding amino acid metabolism in yeast?

YKL044W deletion affects amino acid homeostasis as demonstrated by metabolic profiling studies . This makes it a useful model for investigating:

  • Regulatory networks governing amino acid biosynthesis and catabolism

  • Connections between primary metabolism and stress responses

  • Novel factors affecting metabolic regulation

When designing such studies, researchers should:

  • Include comprehensive metabolite analysis beyond amino acids

  • Monitor changes under various nutrient conditions and stresses

  • Integrate transcriptomic and proteomic data to identify affected pathways

  • Consider potential indirect effects through PHD1 regulation, since YKL044W is located within its UTR

The metabolic signature of YKL044W deletion can be compared with those of known regulatory mutants to place this gene within the broader context of metabolic regulation networks in yeast.

How could high-throughput screening approaches be designed to identify small molecules affecting YKL044W function?

To design high-throughput screens for identifying molecules affecting YKL044W function, researchers could implement the following approaches:

  • Reporter-based assays: Creating fusion constructs with reporter genes (GFP, luciferase) to monitor expression or activity

  • Phenotypic screens: Assessing growth rates or metabolic profiles of YKL044W deletion or overexpression strains in the presence of compound libraries

  • Protein-based assays: Using purified recombinant YKL044W in biochemical assays to identify direct binding partners

A potential screening workflow would involve:

  • Primary screen using a reporter system in yeast cells

  • Secondary validation in deletion strains

  • Tertiary confirmation using purified protein

  • Target engagement studies to confirm direct interactions

These screens could identify both inhibitors and activators of YKL044W function, providing chemical probes for further functional studies and potentially revealing novel aspects of its biological role.

What are the challenges in distinguishing the phenotypic effects of YKL044W deletion from those of disrupting the PHD1 UTR?

Distinguishing the phenotypic effects of YKL044W deletion from potential effects on PHD1 regulation presents significant experimental challenges:

  • Genomic Overlap: Since YKL044W is located within the UTR of PHD1 , deletion may affect PHD1 expression or regulation

  • Regulatory Elements: The UTR might contain regulatory elements affecting PHD1 translation or mRNA stability

  • Potential Functional Relationship: The proteins may have evolved coordinated functions due to their genomic proximity

To address these challenges, researchers should implement:

  • Precise Genomic Editing: Using CRISPR-Cas9 to introduce specific mutations that disrupt YKL044W coding potential without altering the UTR sequence

  • Compensatory Expression: Creating strains where YKL044W is deleted but expressed from an alternative locus

  • PHD1 Expression Analysis: Carefully monitoring PHD1 mRNA and protein levels in all YKL044W mutants

  • Epistasis Analysis: Determining whether PHD1 overexpression can rescue YKL044W deletion phenotypes

What bioinformatic approaches can predict potential functions of YKL044W based on its sequence and available omics data?

Multiple bioinformatic approaches can be leveraged to predict potential functions of uncharacterized proteins like YKL044W:

  • Sequence-Based Predictions:

    • Homology searches across species to identify conserved domains

    • Secondary structure prediction to identify functional motifs

    • Detection of targeting signals and transmembrane domains

  • Structural Predictions:

    • Ab initio or homology-based 3D structure modeling

    • Protein-protein interaction surface prediction

    • Ligand-binding site identification

  • Integrative Omics Analysis:

    • Correlation analysis with gene expression data across conditions

    • Integration with metabolomic signatures as described in the Metabolic Gene Card

    • Analysis of genetic interaction profiles

    • Protein interaction network positioning

Data TypeAnalysis MethodPotential Insight
SequenceHidden Markov ModelsIdentification of conserved domains or motifs
StructureAlphaFold or similarPrediction of 3D structure and functional sites
ExpressionCo-expression networksIdentification of co-regulated genes
MetabolomicsPathway impact analysisMetabolic pathways potentially affected
Genetic interactionsEnrichment analysisBiological processes and functions

Researchers should implement these approaches as complementary lines of evidence, with experimental validation of the most compelling predictions to gradually build a functional profile of this uncharacterized protein.

What are the most promising research directions for elucidating the biological function of YKL044W?

Based on the available information, several promising research directions emerge for investigating YKL044W function:

  • Detailed Metabolic Characterization: Expanding on the amino acid profiling data to include comprehensive metabolomics under various conditions

  • Regulatory Relationship with PHD1: Investigating the potential co-regulation or functional relationship between YKL044W and PHD1, given their genomic arrangement

  • Protein Interaction Studies: Using the available recombinant protein to identify interaction partners through techniques like affinity purification-mass spectrometry

  • Evolutionary Analysis: Examining the conservation and evolution of this genomic arrangement across fungal species

  • Stress Response Profiling: Testing the YKL044W deletion strain under various stress conditions to identify condition-specific phenotypes

These approaches, particularly when combined in an integrative analysis framework, have the potential to reveal the biological context and function of this uncharacterized protein.

How can contradictory findings in YKL044W research be reconciled through experimental design?

When facing contradictory findings in YKL044W research, researchers should implement systematic approaches to resolve discrepancies:

  • Standardization of Genetic Backgrounds: Ensure all strains have identical genetic backgrounds except for the specific mutations being studied

  • Control for PHD1 Effects: Create control strains with mutations affecting only PHD1 or only YKL044W to distinguish their effects

  • Condition-Specific Analysis: Test under various growth conditions, as some phenotypes may only manifest under specific circumstances

  • Quantitative Rather Than Qualitative Assessment: Use quantitative measurements (e.g., precise metabolite levels) rather than binary outcomes

  • Independent Methodological Approaches: Confirm findings using multiple independent techniques to rule out method-specific artifacts

By implementing these approaches, researchers can build a more coherent understanding of YKL044W function and resolve apparent contradictions in the literature.

What collaborative research approaches would accelerate understanding of YKL044W function in the broader context of yeast biology?

Accelerating research on YKL044W would benefit from collaborative approaches spanning multiple disciplines:

  • Multi-omics Consortium: Coordinated studies integrating genomics, transcriptomics, proteomics, and metabolomics data from YKL044W mutants

  • Comparative Genomics Collaboration: Analysis of similar genomic arrangements across fungal species to understand evolutionary context

  • Structural Biology Partnership: Determination of YKL044W structure through X-ray crystallography or cryo-EM approaches

  • Synthetic Biology Approaches: Engineering synthetic systems to test hypotheses about YKL044W function in controlled contexts

  • Data Integration Initiative: Development of computational frameworks to integrate diverse experimental data into coherent functional models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.