Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLL053C (YLL053C)

What is YLL053C and how is it classified in genomic databases?

YLL053C is a putative uncharacterized protein from Saccharomyces cerevisiae (strain ATCC 204508 / S288c), commonly known as baker's yeast. In the Saccharomyces Genome Database (SGD), it is cataloged under the systematic name YLL053C, with an alternative ORF name of L0587. The protein is currently classified as "putative uncharacterized," indicating limited functional annotation in major databases . The gene is documented in SGD, which provides comprehensive integrated biological information for S. cerevisiae, including genomic context and sequence data derived from the reference genome of laboratory strain S288C .

What is the amino acid sequence and structural properties of YLL053C?

The full amino acid sequence of YLL053C consists of 152 amino acids:

MWFPQIIAGMAAGGAASAMTPGKVLFTNALGLGCSRSRGLFLEMFGTAVLCLTVLMTAVEKRETNFMAALPIGISLFMAHMALTGYTGTGVNPARSLGAAVAARYFPHYHWIYWISPLLGAFLAWSVWQLLQILDYTTYVNAEKAAGQKKED

The protein has a Uniprot accession number of P0CD98, and its expression region spans positions 1-152, representing the full-length protein . Based on its amino acid composition, the protein appears to contain hydrophobic regions that are characteristic of membrane-associated proteins, which aligns with its potential role in transport functions as suggested by some research findings .

What are the recommended storage and handling conditions for recombinant YLL053C protein?

For optimal stability, recombinant YLL053C protein should be stored at -20°C, with extended storage preferably at -80°C. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, specifically optimized for this protein's stability . Researchers should avoid repeated freezing and thawing cycles, as this can compromise protein integrity. For ongoing experiments, working aliquots may be stored at 4°C for up to one week, but no longer, to prevent degradation . When handling the protein, standard precautions for recombinant proteins should be observed, including the use of sterile technique and appropriate personal protective equipment.

How can researchers effectively disrupt YLL053C for functional characterization studies?

CRISPR-Cas9 mediated transporter disruption has been demonstrated as an efficient method for characterizing transporters like YLL053C. Recent research has established protocols for generating transporter disruption libraries in yeast to study their influence on metabolite levels . To implement this approach for YLL053C specifically:

• Design guide RNAs targeting the YLL053C open reading frame

• Transform the CRISPR-Cas9 construct into the appropriate S. cerevisiae strain

• Verify disruption through sequencing or PCR-based genotyping

• Assess phenotypic changes using relevant biosensor systems

When conducting disruption experiments, it is essential to include appropriate controls and to consider the potential for off-target effects. Studies have shown that YLL053C disruption can significantly impact metabolite yields, with different effects observed for different compounds, suggesting a role in metabolite transport or regulation .

What biosensor systems are appropriate for studying the functional consequences of YLL053C disruption?

Biosensor systems utilizing transcription factors coupled with fluorescent reporters have proven effective for studying transporter function in S. cerevisiae. For investigating YLL053C specifically, researchers have successfully employed:

• Transcription factor-based biosensors (e.g., PcaQ-based systems for PCA detection)

• Fluorescent reporter systems (typically GFP) under the control of metabolite-responsive elements

These biosensors should be implemented in the appropriate strain background, with optimization of media conditions being crucial for reliable results. It's important to note that biosensor responses are dependent on intracellular metabolite concentrations, which may correlate differently with extracellular concentrations depending on the transporter's nature . Therefore, validation of biosensor data with direct metabolite measurements is strongly recommended.

Media selection significantly impacts biosensor performance - researchers have observed that mineral medium (MM) at pH 4.5 or pH 6.0 provides better results than YPD or synthetic defined media when using certain biosensors such as the PcaQ system for PCA detection .

What experimental design principles should be considered when conducting YLL053C research?

When designing experiments to investigate YLL053C function, researchers should adhere to rigorous experimental design principles as outlined in guidelines for preclinical pharmacological research:

• Include appropriate controls (positive, negative, and vehicle controls where applicable)

• Ensure adequate sample sizes based on power calculations

• Implement randomization and blinding where possible

• Control for batch effects and environmental variables

• Report all experimental conditions comprehensively

Furthermore, when reporting results related to YLL053C studies, authors should provide essential information required for reproducibility, including detailed methodological descriptions, statistical analyses performed, and complete data presentation . This approach is particularly important for studies involving putative uncharacterized proteins like YLL053C, where functional characterization is still evolving.

How does YLL053C disruption affect metabolite production in S. cerevisiae?

Experimental evidence indicates that YLL053C disruption has significant but varying effects on different metabolic pathways. Studies have shown that:

This differential impact suggests that YLL053C may play a complex role in metabolite transport or regulation, potentially affecting multiple pathways differently. The mechanism behind these effects remains to be fully elucidated, but could involve direct transport activity, influence on membrane integrity, or indirect effects on cellular metabolism and homeostasis .

How does YLL053C compare functionally to other transporters in Saccharomyces cerevisiae?

Comparative analyses place YLL053C among transporters that show similar functional patterns in disruption studies. Based on metabolite production phenotypes, transporters can be categorized into distinct functional groups:

YLL053C belongs to Group I, wherein disruption results in increased CCM yield but decreased PCA yield . This classification provides valuable information for researchers interested in metabolic engineering and transporter function. Interestingly, combination studies involving multiple transporter disruptions, including YLL053C, failed to provide additive improvements in CCM production compared to single disruptions, suggesting potential compensatory mechanisms or broader metabolic perturbations .

What approaches can be used to determine the subcellular localization of YLL053C?

To determine the subcellular localization of YLL053C, researchers can employ several complementary approaches:

• Fluorescent protein tagging:

  • C-terminal or N-terminal fusion with GFP or other fluorescent proteins

  • Visualization using confocal microscopy

  • Consideration of potential interference with protein function

• Subcellular fractionation followed by Western blotting:

  • Careful separation of membrane fractions (plasma membrane, vacuolar membrane, mitochondrial membrane)

  • Use of specific antibodies against YLL053C or epitope tags

  • Comparison with known compartment markers

• Immunogold electron microscopy:

  • Ultra-structural localization at high resolution

  • Requires specific antibodies against YLL053C

When interpreting localization data, it's important to consider that YLL053C's amino acid sequence (MWFPQIIAGMAAGGAASAMTPGKVLFTNALGLGCSRSRGLFLEMFGTAVLCLTVLMTAVEKRETNFMAALPIGISLFMAHMALTGYTGTGVNPARSLGAAVAARYFPHYHWIYWISPLLGAFLAWSVWQLLQILDYTTYVNAEKAAGQKKED) contains hydrophobic regions consistent with membrane localization , supporting its putative role as a transporter.

How can transcriptome analysis be applied to better understand YLL053C function?

Transcriptome analysis represents a powerful approach to elucidate YLL053C function by examining global gene expression changes in response to its disruption or overexpression. Researchers can implement this strategy by:

• Performing RNA-Seq or microarray analysis comparing wild-type and YLL053C-disrupted strains

• Analyzing data under varying conditions (e.g., different carbon sources or stress conditions)

• Identifying co-regulated genes that may function in similar pathways

Previous transcriptome studies in respiratory S. cerevisiae strains have demonstrated the value of this approach for identifying functional relationships between genes and metabolic pathways . When analyzing transcriptome data, researchers should be aware of potential opposite-direction changes that may occur between different datasets, as observed in some respiratory yeast studies where certain genes showed contradictory expression patterns across different experimental conditions .

What methodological approaches can resolve discrepancies in YLL053C functional data?

When encountering contradictory results regarding YLL053C function, researchers should consider implementing the following methodological approaches:

• Strain-specific effects investigation:

  • Compare phenotypes across multiple strain backgrounds

  • Document genetic differences between strains used in different studies

• Conditional functionality assessment:

  • Test function under various media compositions

  • Examine effects under different growth phases and stress conditions

• Multi-omics integration:

  • Combine transcriptomics, proteomics, and metabolomics data

  • Use systems biology approaches to model complex interactions

• Complementation studies:

  • Reintroduce wild-type or mutated versions of YLL053C to disruption strains

  • Assess rescue of phenotypes to confirm direct causality

These approaches can help resolve apparent contradictions, such as the differential effects of YLL053C disruption on different metabolites (increased CCM yield versus decreased PCA yield) , by providing a more complete understanding of the protein's context-dependent functions.

How might YLL053C function be involved in stress response pathways in yeast?

Although direct evidence for YLL053C involvement in stress response is limited, its potential role can be investigated through:

• Expression profiling under various stress conditions:

  • Oxidative stress

  • Osmotic stress

  • Nutrient limitation

  • Temperature shifts

• Phenotypic analysis of YLL053C-disrupted strains under stress:

  • Growth rate comparisons

  • Viability assessments

  • Metabolite production changes

• Interaction studies with known stress response proteins:

  • Co-immunoprecipitation

  • Yeast two-hybrid analysis

  • Genetic interaction mapping

Transporter-mediated stress responses often involve regulation of ion homeostasis, nutrient acquisition, or export of toxic compounds. The differential effects of YLL053C disruption on metabolite production suggest it could play a role in cellular homeostasis under specific conditions, potentially contributing to stress adaptation mechanisms.

What are the most promising approaches for determining the specific substrates of YLL053C?

To identify the specific substrates of YLL053C, researchers should consider implementing the following approaches:

• Direct transport assays:

  • Expression in heterologous systems (e.g., Xenopus oocytes)

  • Radiolabeled or fluorescently labeled substrate uptake measurements

  • Competition assays with potential substrates

• Metabolomics profiling:

  • Comparative metabolomics of wild-type and YLL053C-disrupted strains

  • Targeted analysis of key metabolite classes

  • Flux analysis using isotope-labeled precursors

• Structural prediction and docking:

  • Homology modeling based on related transporters

  • In silico docking of potential substrates

  • Validation of predictions through site-directed mutagenesis

These approaches, particularly when used in combination, can provide complementary evidence for substrate specificity. The existing data showing YLL053C disruption affects both CCM and PCA levels provides initial clues about metabolic pathways that may be directly or indirectly influenced by this putative transporter.

How can CRISPR-Cas9 technology be optimized for YLL053C functional studies beyond simple disruption?

CRISPR-Cas9 technology offers sophisticated approaches for YLL053C functional studies beyond straightforward gene disruption:

• Base editing for introducing specific mutations:

  • Create point mutations without double-strand breaks

  • Generate allelic series to probe structure-function relationships

  • Modify potential regulatory regions

• CRISPRi/CRISPRa for modulating expression:

  • Implement CRISPR interference to reduce expression

  • Use CRISPR activation to increase expression

  • Create conditional expression systems

• Domain-specific tagging:

  • Precise insertion of epitope or fluorescent tags

  • Minimal disruption of protein function

  • Targeting specific domains for functional analysis

When implementing these advanced CRISPR approaches, researchers should carefully design guide RNAs to minimize off-target effects and validate editing efficiency using appropriate sequencing methods. The efficiency of CRISPR-Cas9 for transporter disruption has been demonstrated in yeast studies , suggesting these more sophisticated applications would be technically feasible for YLL053C functional characterization.