Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLL059C (YLL059C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and this can serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. To ensure a specific tag type, please inform us during your order, and we will prioritize its implementation.
Synonyms
YLL059C; L0563; Putative uncharacterized protein YLL059C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YLL059C
Target Protein Sequence
MCMCVVLVYFSILLDKGTKVLYTHDNNWLVILVFYFLAFGSIMRISGRTCSEEMKKSFGQ ASYHNGLQNFSKESPVGVNLEKKKTHISCCIILATQRFLQKFSNKRLGNPHLHPTRESTF SRELATENNSGNFPVLLRYHIFRQLDIENGILLCQVLQALIIVQVMFS
Uniprot No.

Target Background

Database Links

STRING: 4932.YLL059C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does YLL059C compare to other uncharacterized yeast proteins?

YLL059C belongs to a category of putative proteins in S. cerevisiae that lack functional characterization. Its study methodology parallels approaches used for other yeast ORFs like YLL056C, which was recently characterized as an NADH-dependent aldehyde reductase in the atypical subgroup of the short-chain dehydrogenase/reductase (SDR) family .

Unlike YLL056C which has demonstrated NADH-dependent aldehyde reductase activity with specificity for multiple aldehyde substrates, YLL059C's enzyme activity (if any) remains undetermined. The characterization pattern established for proteins like YLL056C provides a methodological framework for investigating YLL059C through systematic analyses of expression conditions, subcellular localization, and substrate preferences .

What expression systems are most effective for producing recombinant YLL059C?

E. coli expression systems have been successfully employed to produce recombinant YLL059C with N-terminal His tags. The protein can be expressed as a full-length construct (1-168aa) and purified to >90% homogeneity as determined by SDS-PAGE .

For optimal expression, researchers should consider the following protocol elements:

  • Vector selection with appropriate promoter strength

  • Codon optimization for E. coli if expression levels are suboptimal

  • Expression temperature optimization (typically 16-30°C)

  • Induction conditions (IPTG concentration for T7-based systems)

The resulting protein is typically obtained as a lyophilized powder that requires reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with recommended addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

What experimental approaches are most suitable for determining YLL059C function?

A comprehensive experimental design for YLL059C functional characterization should employ multiple complementary approaches:

Genetic Approaches:

  • Gene deletion/knockout studies to observe phenotypic changes

  • Synthetic lethality screens to identify genetic interactions

  • Overexpression studies to identify gain-of-function phenotypes

Biochemical Approaches:

  • Recombinant protein expression and purification

  • In vitro activity assays with diverse substrate panels

  • Protein-protein interaction studies (pull-downs, co-immunoprecipitation)

The synthetic dosage lethality (SDL) screen methodology has proven particularly effective for uncharacterized yeast proteins. This approach involves transferring YLL059C expression plasmids into yeast knockout libraries using selective ploidy ablation (SPA), followed by systematic analysis of growth phenotypes to identify genetic interactions .

For proteins like YLL056C, upregulation patterns under specific conditions (such as exposure to furfural) provided crucial clues to function. Similar stress-response profiling could reveal YLL059C's physiological role .

How can researchers effectively design parallel and crossover experiments for YLL059C characterization?

When designing mechanistic studies for YLL059C, researchers should consider implementing parallel and crossover experimental designs to strengthen causal inferences about protein function.

In a parallel design approach for YLL059C:

  • Divide experimental units (yeast strains) randomly into two groups

  • In the first group, manipulate only YLL059C expression

  • In the second group, manipulate both YLL059C and a suspected mediator protein

  • Compare outcomes to distinguish direct effects from those mediated by interacting partners

For a crossover design:

  • Sequentially assign experimental units to two experimental conditions

  • First randomize YLL059C expression levels

  • Then assign subsequent conditions based on previous results without randomization

  • This design improves identification power compared to single-experiment approaches

What localization studies are recommended for YLL059C?

Protein localization provides critical insights into function. For YLL059C, researchers should implement:

GFP Fusion Approaches:

  • C-terminal and N-terminal GFP tagging strategies (considering potential disruption of targeting sequences)

  • Live-cell fluorescence microscopy under various growth conditions

  • Co-localization studies with organelle-specific markers

Biochemical Fractionation:

  • Subcellular fractionation followed by Western blot analysis

  • Membrane extraction protocols to test predicted membrane association

The methodology successfully applied to YLL056C, which was localized to the cytoplasm using protein-GFP fusion constructs, serves as a useful template . For YLL059C, special attention should be paid to potential membrane localization given its sequence characteristics suggestive of transmembrane domains .

How can researchers develop a systematic expression analysis for YLL059C?

A comprehensive expression analysis for YLL059C should include:

Transcriptional Profiling:

  • qRT-PCR analysis across diverse growth conditions and stress responses

  • RNA-seq for genome-wide context of expression patterns

  • Promoter analysis to identify regulatory elements

Methodology for qRT-PCR analysis:

  • Extract RNA using standard yeast protocols (hot phenol or commercial kits)

  • Perform reverse transcription with oligo(dT) primers

  • Conduct qPCR using validated primers specific to YLL059C

  • Use reference genes such as ACT1 or ALG9 for normalization

  • Analyze using comparative Ct method (2^-ΔΔCt)

Based on findings from YLL056C, researchers should specifically investigate YLL059C expression under various stress conditions, as YLL056C showed significant upregulation under high furfural or 5-(hydroxymethyl)-2-furaldehyde exposure, with transcription factors Yap1p, Hsf1p, Pdr1/3p, Yrr1p, and Stb5p controlling its upregulated transcription .

What protein-protein interaction methodologies are most suitable for YLL059C studies?

To elucidate YLL059C's functional network, researchers should implement:

In vivo approaches:

  • Yeast two-hybrid screening

  • Proximity-dependent biotin identification (BioID)

  • Co-immunoprecipitation with tagged YLL059C

In vitro approaches:

  • Pull-down assays using purified recombinant His-tagged YLL059C

  • Surface plasmon resonance to measure binding kinetics

  • Crosslinking mass spectrometry for structural interaction data

For Western blot validation of interactions, researchers should follow protocols similar to those used in related studies:

  • Harvest cells by trypsinization

  • Lyse in elution buffer (150 mM NaCl, 0.1% NP-40, 5 mM EDTA, 50 mM HEPES pH 7.5) with protease inhibitors

  • Process samples at 4°C and load 20 μg on 10% polyacrylamide gels

  • Transfer to PVDF membranes and block in appropriate buffer

  • Incubate with validated primary antibodies

  • Visualize using appropriate secondary antibodies and imaging systems

What are the recommended enzyme activity assays if YLL059C exhibits catalytic function?

If YLL059C possesses enzymatic activity, a systematic approach to characterization would include:

Initial screening assays:

  • Dehydrogenase/reductase activity with NAD(P)H cofactors

  • Hydrolase activity across diverse substrate panels

  • Transferase activity with various donor/acceptor combinations

Detailed kinetic characterization:

  • Determination of optimal pH and temperature

  • Substrate specificity profiling

  • Cofactor requirements

  • Inhibition studies

ParameterMeasurement MethodExpected Output
Optimal pHActivity measurements in buffers ranging from pH 4.0-9.0pH optimum curve
Temperature optimumActivity measurements at 4-50°CTemperature optimum curve
Substrate specificityActivity with diverse substrates at standardized conditionsRelative activity (%)
Kinetic parametersVarying substrate concentrations at optimal conditionsKm, Vmax, kcat, kcat/Km values

Based on the characterization approach used for YLL056C, researchers should test YLL059C against aldehyde substrates including glycolaldehyde, furfural, formaldehyde, butyraldehyde, and propylaldehyde, as well as evaluate the effects of metal ions, salts, and chemical additives on activity .

How should researchers analyze growth phenotype data in YLL059C functional studies?

For growth phenotype analysis in YLL059C studies, implement:

Colony formation quantification:

  • Seed cells at 40,000 cells/well in 12-well plates

  • Incubate for 5 days under appropriate conditions

  • Fix with 4% formaldehyde and stain with crystal violet

  • Quantify by eluting with 10% acetic acid and measuring absorbance at 590 nm

Growth curve analysis:

  • Monitor growth in liquid culture at regular intervals (OD600)

  • Calculate growth parameters (lag phase, doubling time, maximum OD)

  • Compare YLL059C wildtype, deletion, and overexpression strains

For spot assays:

  • Grow cells overnight in appropriate selective media

  • Perform serial dilutions

  • Spot onto selective media (with and without galactose for inducible expression)

  • Incubate at appropriate temperatures and document growth daily

When analyzing synthetic lethality screens, identify significant genetic interactions using appropriate statistical methods with p-value cutoffs (typically p<0.05) .

What approaches are recommended for resolving conflicting experimental results with YLL059C?

When faced with conflicting experimental results:

  • Systematic validation strategy:

    • Repeat experiments with standardized conditions

    • Employ multiple complementary methodologies

    • Use appropriate positive and negative controls

    • Validate key findings in different strain backgrounds

  • Experimental design considerations:

    • Investigate strain-specific effects (different genetic backgrounds)

    • Test condition-dependent functions (stress, nutrient availability)

    • Examine tag interference (compare N- and C-terminal tagged constructs)

    • Consider post-translational modifications that might vary between experiments

  • Advanced troubleshooting:

    • Implement parallel design experiments to identify potential mediating factors

    • Use crossover experimental designs to strengthen causal inferences when results are ambiguous

    • Consider unintended manipulation effects in experimental setups

What are the most promising research directions for YLL059C?

Based on current knowledge and methodological approaches, the most promising research directions include:

  • Comprehensive characterization of YLL059C's role in stress responses, particularly testing conditions that induced similar uncharacterized proteins like YLL056C

  • Investigation of potential enzymatic activities, systematically testing substrate panels based on sequence features

  • Integration of YLL059C into the broader context of yeast membrane biology if localization studies confirm predicted membrane association

  • Exploration of conservation and potential homologs in other organisms to identify evolutionarily preserved functions

How should researchers integrate multiple data types in YLL059C studies?

For comprehensive understanding of YLL059C function, researchers should:

  • Develop integrated analysis workflows that combine:

    • Phenotypic data from growth assays

    • Protein-protein interaction networks

    • Transcriptomic responses to YLL059C perturbation

    • Localization and functional assay results

  • Implement data visualization strategies that highlight relationships between:

    • Genetic interactions and physical interactions

    • Expression patterns and phenotypic outcomes

    • Structural features and functional properties

  • Utilize statistical approaches for multi-omics data integration:

    • Principal component analysis for dimensionality reduction

    • Network-based data integration methods

    • Machine learning approaches to identify patterns across datasets

The comprehensive characterization strategy that successfully classified YLL056C as an NADH-dependent aldehyde reductase provides an excellent template for YLL059C investigation, integrating expression analyses, localization studies, and systematic enzymatic characterization .

What standardization practices should be adopted for YLL059C research?

To ensure reproducibility and comparability across studies:

  • Reagent standardization:

    • Use consistent recombinant protein preparation methods

    • Standardize storage conditions (buffer composition, temperature)

    • Document batch-to-batch variation in activity assays

  • Protocol standardization:

    • Follow established guidelines for Western blot analysis similar to those used in related studies

    • Implement consistent reconstitution protocols for lyophilized protein (0.1-1.0 mg/mL in deionized sterile water)

    • Adopt standardized storage practices (addition of 5-50% glycerol for long-term storage)

  • Reporting standards:

    • Document full experimental conditions

    • Report all statistical analyses comprehensively

    • Share raw data through appropriate repositories

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.