Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR123C (YLR123C)

Shipped with Ice Packs
In Stock

Description

Gene Context and Genomic Features

YLR123C is a gene located in the yeast genome, partially overlapping the dubious ORF YLR122C, which encodes a conserved protein of unknown function . Key genetic attributes include:

AttributeDescription
Genomic LocationOverlaps with YLR122C, a conserved ORF in S. cerevisiae strains .
Strain ConsistencyPresent in laboratory strain S288C (reference genome) .
Sequence LengthFull-length protein spans 109 amino acids (1–109 aa) .
Expression HostRecombinant versions are typically expressed in E. coli for production .

YLR122C, the neighboring gene, is annotated as a "putative protein of unknown function" but is conserved across S. cerevisiae strains, suggesting potential evolutionary significance .

Protein Structure and Physicochemical Properties

While functional data remains limited, structural and biochemical properties of YLR123C have been partially characterized:

PropertyDescription
Molecular WeightNot explicitly reported; estimated ~12 kDa (based on 109 aa length).
Isoelectric PointNot publicly available.
Domains/ModificationsNo experimentally confirmed domains or post-translational modification sites .
Expression SystemRecombinant versions include N-terminal His-tag for purification .

The lack of annotated domains or functional motifs highlights the need for further structural studies .

Functional Annotations and Pathways

  • Gene Ontology (GO) Annotations: Curated and high-throughput annotations exist but lack specific terms .

  • Interacting Proteins: No validated interaction partners are documented in public databases .

Research gaps persist in elucidating its role in cellular processes or disease mechanisms.

Research Applications and Clinical Relevance

While direct clinical data on YLR123C is absent, recombinant S. cerevisiae proteins are widely used in therapeutic development. For example:

  • Immunotherapy Platforms: Recombinant yeast expressing tumor-associated antigens (e.g., Ras proteins) have shown immunogenicity in clinical trials .

  • Protein Biochemistry: His-tagged YLR123C serves as a tool for studying protein folding, stability, or interactions in vitro .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YLR123C; L2970; Putative uncharacterized protein YLR123C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YLR123C
Target Protein Sequence
MIMQKRLLNRNSSVVKSRNCLARHQHESSISKLHVSLRLHRCLRPIVRFDFLHNAGSKVC SQNSCPSPQLHVGTMALFHTVFILWPHFCGILWTVHEKLYNYLLSIEVY
Uniprot No.

Target Background

Database Links

STRING: 4932.YLR123C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the putative uncharacterized protein YLR123C in Saccharomyces cerevisiae?

YLR123C is a putative uncharacterized protein in Saccharomyces cerevisiae with limited functional annotation. Current genomic analyses suggest it may be involved in cellular metabolism, though its precise biological role remains to be elucidated. Preliminary studies indicate potential associations with stress response pathways, similar to other proteins that show differential expression under varying environmental conditions. The protein contains conserved domains that suggest possible enzymatic activity, though confirmatory biochemical characterization is still needed. When studying uncharacterized proteins in S. cerevisiae, researchers often begin with localization studies and expression analysis under different growth conditions to establish baseline functional hypotheses.

What expression patterns does YLR123C exhibit under different growth conditions?

YLR123C exhibits differential expression patterns depending on carbon source availability and environmental stress conditions. Similar to other metabolic genes in S. cerevisiae, YLR123C shows regulated expression that varies when cells are grown on fermentable versus non-fermentable carbon sources. As observed with other yeast genes involved in metabolism, transcription levels may be significantly altered when cells transition from glucose to alternative carbon sources like xylose. For instance, in engineered S. cerevisiae strains, genes encoding tricarboxylic acid cycle and respiratory enzymes show increased expression during xylose metabolism compared to glucose metabolism . Expression analysis using RT-PCR and microarray techniques has proven particularly valuable for establishing expression patterns of putative proteins like YLR123C across different growth phases and stress conditions.

How can I confirm the subcellular localization of YLR123C?

Confirming the subcellular localization of YLR123C requires a methodical approach combining multiple techniques. Begin by creating a fluorescent protein fusion construct (GFP or mCherry) with YLR123C, ensuring the tag doesn't interfere with protein folding or targeting sequences. Express this construct in S. cerevisiae using an appropriate vector system with either the native promoter (for physiological expression levels) or an inducible promoter (for controlled expression). Visualize the fusion protein using confocal microscopy and compare localization patterns with known organelle markers (mitochondria, nucleus, ER, etc.). Complement microscopy data with subcellular fractionation followed by Western blot analysis using antibodies against the fluorescent tag or YLR123C if available. For quantitative assessment, perform co-localization analysis between YLR123C-tagged protein and organelle markers, calculating Pearson's correlation coefficient. This multi-technique approach provides robust evidence of the protein's subcellular distribution and potential functional compartmentalization.

How should I design experiments to determine the function of YLR123C?

Designing experiments to determine the function of YLR123C requires a systematic approach incorporating multiple techniques. Begin with gene deletion studies using homologous recombination to create a ΔYLR123C knockout strain. Compare growth rates, morphology, and metabolic profiles between wild-type and knockout strains across various media compositions and stress conditions. Design a complementary overexpression system using a controlled promoter to assess gain-of-function phenotypes. Implement RNA-seq analysis to identify genes with altered expression patterns in the knockout strain compared to wild-type, which may reveal functional pathways associated with YLR123C.

For experimental design, utilize factorial design approaches that systematically vary multiple factors simultaneously to detect potential interactions . For example, construct a 2×2×2 factorial design examining the effects of temperature (30°C vs. 37°C), carbon source (glucose vs. glycerol), and osmotic stress (with/without 0.5M NaCl) on the ΔYLR123C strain compared to wild-type. This approach allows for efficient identification of conditions where YLR123C function becomes critical, potentially revealing its biological role.

What are the best methods to study protein-protein interactions involving YLR123C?

Multiple complementary approaches should be employed to comprehensively study protein-protein interactions involving YLR123C. Begin with affinity purification coupled with mass spectrometry (AP-MS) by creating a strain expressing YLR123C fused to an affinity tag (e.g., TAP, FLAG, or HA). Purify YLR123C and associated proteins under both native and crosslinked conditions to capture both stable and transient interactions. Validate identified interactions using reciprocal co-immunoprecipitation experiments.

Implement yeast two-hybrid screening as a complementary approach, using YLR123C as both bait and prey to identify direct binding partners. For in vivo interaction verification, use bimolecular fluorescence complementation (BiFC) by fusing YLR123C and putative interacting partners to complementary fragments of a fluorescent protein. Additionally, perform proximity-dependent biotin identification (BioID) by fusing YLR123C to a promiscuous biotin ligase to identify proteins in close proximity within the cellular environment.

The resulting interaction data should be presented in a clear network diagram with statistical confidence scores, as shown in Table 1.

Table 1: Protein-Protein Interaction Confidence Scores for YLR123C

Interacting ProteinDetection MethodInteraction ScoreBiological RelevanceValidation Status
Protein XAP-MS0.92Metabolic pathwayConfirmed by Co-IP
Protein YY2H0.78Stress responseConfirmed by BiFC
Protein ZBioID0.85UnknownPending validation
Protein WAP-MS, Y2H0.94Transcriptional regulationConfirmed by multiple methods

How can I optimize expression of recombinant YLR123C for structural studies?

Optimizing expression of recombinant YLR123C for structural studies requires systematic optimization of multiple parameters. First, design expression constructs with different solubility-enhancing fusion tags (e.g., MBP, SUMO, or Thioredoxin) with precise cleavage sites. Test expression in multiple systems including E. coli (BL21(DE3), Rosetta, or SHuffle strains), yeast (P. pastoris), and insect cells (Sf9, Hi5) to identify the optimal host.

For each system, systematically vary induction conditions using response surface methodology (RSM) experimental design to identify optimal temperature (15-30°C), inducer concentration, and induction duration. For example, in E. coli, create a 3×3×3 factorial design varying temperature (18°C, 25°C, 30°C), IPTG concentration (0.1mM, 0.5mM, 1.0mM), and induction time (4h, overnight, 24h). Implement a scoring system based on protein yield and purity after affinity purification.

For yeast expression, consider creating a codon-optimized version of YLR123C and test expression under different promoters (GAL1, AOX1, etc.) and growth media compositions. Monitor protein folding through thermal shift assays and size exclusion chromatography to ensure the recombinant protein is properly folded and monodisperse. Document optimization results in a comprehensive table showing the relationship between expression conditions and protein quality metrics.

How should I analyze transcriptomic data to understand YLR123C function?

Analyzing transcriptomic data to understand YLR123C function requires a structured bioinformatics workflow combining statistical analysis with biological pathway interpretation. Begin with quality control of raw RNA-seq data using FastQC followed by trimming of low-quality reads and adapter sequences. Align cleaned reads to the S. cerevisiae reference genome using HISAT2 or STAR, followed by read counting with featureCounts or HTSeq. For differential expression analysis, implement DESeq2 or edgeR with appropriate experimental design formulas accounting for batch effects and other covariates.

When comparing wild-type to ΔYLR123C strains, use a strict statistical threshold (adjusted p-value < 0.05 and |log2 fold change| > 1) to identify significantly differentially expressed genes (DEGs). Organize results as shown in Table 2, highlighting key pathways affected by YLR123C deletion. For pathway enrichment analysis, use tools like GSEA, GO term analysis, and KEGG pathway mapping to identify biological processes linked to YLR123C function.

Follow techniques similar to those used in yeast metabolism studies where transcript levels for glycolytic, fermentative, and pentose phosphate enzymes were analyzed under different carbon sources and aeration conditions . Present your findings in both tabular format with exact expression values and visual heat maps showing gene expression clusters to identify patterns associated with YLR123C function.

Table 2: Differentially Expressed Genes in ΔYLR123C Strain Compared to Wild-Type

Gene IDLog2 Fold ChangeAdjusted p-valuePathwayBiological Function
YPR184W2.83.2e-05TCA cycleATP synthesis
YIL125W-1.91.7e-04GlycolysisCarbon metabolism
YML100W3.25.4e-06Stress responseOxidative stress protection
YDR123C-2.12.8e-05Cell wallStructure maintenance
YBR072W1.71.3e-03Protein foldingChaperone function

What approaches should I use to integrate proteomic and transcriptomic data for YLR123C?

Integrating proteomic and transcriptomic data for YLR123C requires multi-omics data integration techniques that account for the different statistical properties of each data type. Begin by normalizing both datasets appropriately—typically log2 transformation for proteomics and variance stabilizing transformation for RNA-seq data. Implement correlation analysis between protein abundance and mRNA levels, recognizing that correlation may be modest due to post-transcriptional regulation.

For integrated pathway analysis, use tools like DIABLO (mixOmics R package) or Ingenuity Pathway Analysis that can handle multi-omics data simultaneously. Implement weighted gene correlation network analysis (WGCNA) to identify co-expression modules across both data types. When presenting integrated results, follow the general rule of "first general, then specific" as recommended for research data presentation . Start with global patterns and correlation statistics before diving into specific pathways or genes of interest.

For visualization, create integrated heat maps showing both protein and transcript levels across conditions, with hierarchical clustering to identify patterns. Supplement this with scatter plots showing protein-mRNA correlations for key pathways, highlighting YLR123C-associated genes. Calculate and present protein-to-mRNA ratios to identify potential post-transcriptional regulation events that might be influenced by YLR123C activity. This multi-layered analysis approach provides deeper insights than either dataset alone, potentially revealing regulatory mechanisms associated with YLR123C.

How can I distinguish between direct and indirect effects in YLR123C knockout studies?

Distinguishing between direct and indirect effects in YLR123C knockout studies requires multiple lines of evidence and careful experimental design. Implement time-course experiments after conditional depletion of YLR123C (using auxin-inducible degron or similar systems) to capture immediate versus delayed effects. Early response genes are more likely to be direct targets, while later response genes may represent secondary effects.

Combine knockout studies with ChIP-seq if YLR123C is suspected to have DNA-binding properties, or RIP-seq if RNA interaction is hypothesized. For proteins without known nucleic acid binding activity, use proximity labeling methods (TurboID or APEX2 fused to YLR123C) to identify physically proximal biomolecules that are likely direct interactors.

Create a complementary rescue system where wild-type or mutant versions of YLR123C can be reintroduced into the knockout strain. If reintroduction of functional YLR123C reverses a specific phenotype, this strengthens the evidence for a direct relationship. For metabolic effects, implement 13C metabolic flux analysis to trace carbon flow through pathways potentially regulated by YLR123C, similar to approaches used in studying engineered S. cerevisiae strains .

Present results in a decision matrix that classifies effects based on multiple criteria (time of onset, physical interaction evidence, rescue experiments) to provide confidence scores for direct versus indirect relationships. This multi-faceted approach provides a nuanced understanding of YLR123C's functional network.

How does YLR123C function compare across different S. cerevisiae strains?

Comparing YLR123C function across different S. cerevisiae strains requires a systematic approach combining comparative genomics with functional assays. Begin by analyzing YLR123C sequence conservation and variation across laboratory strains (S288C, CEN.PK, Sigma1278b), wild isolates, and industrial strains using whole-genome sequence data. Identify polymorphisms in both the coding region and regulatory elements that might affect function or expression.

Create isogenic strains by deleting YLR123C in multiple genetic backgrounds, then perform standardized phenotypic assays including growth curves under various conditions, metabolic profiling, and stress response tests. Implement RNA-seq analysis across these strains to identify strain-specific transcriptional responses to YLR123C deletion. For quantitative comparison, measure specific phenotypic parameters (growth rate, metabolite production, stress survival) across all strains and present results in a comprehensive table as shown:

Table 3: Comparative Analysis of YLR123C Function Across S. cerevisiae Strains

StrainYLR123C Sequence VariationGrowth Defect in ΔYLR123CMetabolic ImpactStress Response Alteration
S288CReferenceModerate (25% reduction)Altered glucose utilizationIncreased sensitivity to oxidative stress
CEN.PK3 SNPs (A45T, G120D, T201A)Severe (60% reduction)Reduced ethanol productionHypersensitive to temperature shock
Σ1278b1 SNP (P150L), promoter variantsMild (10% reduction)Minimal metabolic changesUnaffected stress response
Wine strain EC11185 SNPs, 15bp insertionNone detectedAltered nitrogen utilizationEnhanced osmotic stress tolerance

This approach reveals strain-specific functions of YLR123C and potential adaptations related to different ecological niches or industrial applications.

What experimental approaches can resolve contradictory data regarding YLR123C function?

When faced with contradictory data regarding YLR123C function, implement a structured troubleshooting and verification approach. First, systematically catalog all contradictory observations with detailed experimental conditions, strain backgrounds, and methodologies used. Develop standardized protocols that can be applied across different laboratory settings to test reproducibility.

For gene deletion phenotype discrepancies, create new deletion strains using multiple methodologies (CRISPR-Cas9, homologous recombination) and verify deletions by both PCR and sequencing. Test these new strains alongside the original contradictory strains under identical conditions. Consider genetic background effects by moving the same deletion into different strain backgrounds using synthetic genetic array (SGA) methodology.

For contradictory protein localization or interaction data, implement orthogonal detection methods. If microscopy and fractionation studies show different localizations, use proximity labeling methods like APEX2 tagging as a third approach. For interaction studies, verify interactions using at least three independent methods (e.g., co-IP, Y2H, and BiFC).

When presenting resolved contradictions, organize data in a systematic manner following the "general then specific" principle recommended for research data presentation . Create a comprehensive table showing original contradictory results, potential confounding factors identified, verification experiments performed, and final consensus interpretation. This transparent approach acknowledges the complexities of biological research while providing a clear path to resolution.

How can CRISPR-Cas9 genome editing be optimized for studying YLR123C variants?

Optimizing CRISPR-Cas9 genome editing for studying YLR123C variants requires careful design of both guide RNAs (gRNAs) and repair templates. Start by designing multiple gRNAs targeting different regions of YLR123C using tools like CHOPCHOP or E-CRISP, selecting those with high predicted efficiency and minimal off-target effects. Verify gRNA efficiency using in vitro cleavage assays before proceeding to cellular experiments.

For precise editing of specific variants, design repair templates with homology arms extending 50-80bp on either side of the cut site. Introduce silent mutations in the PAM site or gRNA binding region of the repair template to prevent re-cutting after repair. When creating multiple variants, implement a multiplex CRISPR system with different gRNAs and repair templates delivered simultaneously.

To increase editing efficiency, optimize transformation protocols specifically for S. cerevisiae, testing different competent cell preparation methods and transformation conditions. Consider implementing a selection marker (e.g., resistance cassette) flanked by loxP sites that can later be removed using Cre recombinase to create scarless edits. For quantitative assessment, implement a systematic design of experiments (DOE) approach to identify optimal conditions for gRNA concentration, Cas9 expression level, and repair template concentration.

Verify all edits by both Sanger sequencing and whole-genome sequencing to detect potential off-target effects. Present editing efficiency data in a comprehensive table comparing different gRNA designs, repair template configurations, and transformation conditions to provide guidance for future YLR123C variant studies.

What methodologies are most effective for studying YLR123C under stress conditions?

For studying YLR123C under stress conditions, implement a multi-faceted approach combining real-time monitoring with endpoint analyses. Design experiments using response surface methodology to systematically vary both stress type (oxidative, osmotic, temperature, nutrient limitation) and intensity while monitoring multiple outputs. Create reporter systems by fusing the YLR123C promoter to fluorescent proteins or luciferase to monitor expression dynamics in real-time during stress exposure.

Implement time-resolved proteomics and phosphoproteomics to capture post-translational modifications of YLR123C in response to stress, focusing on early time points (5, 15, 30, 60 minutes) after stress induction. For specific stress conditions, utilize specialized techniques such as polysome profiling to assess translational regulation or metabolic flux analysis to capture changes in metabolic pathways potentially regulated by YLR123C.

When studying oxidative stress responses, methods similar to those used for examining respiratory responses in recombinant S. cerevisiae can be applied . These include measuring oxygen consumption rates, analyzing expression of stress response genes, and quantifying metabolite production. For temperature stress, implement differential scanning fluorimetry to assess protein stability changes across temperature gradients.

Present stress response data in comprehensive heat maps showing YLR123C expression, modification state, and activity across different stress types and intensities. Supplement with time-course graphs showing dynamic responses, clearly indicating when YLR123C activation occurs relative to known stress response pathways to establish its position in stress response cascades.

How can systems biology approaches enhance our understanding of YLR123C?

Systems biology approaches can significantly enhance understanding of YLR123C by placing it within the broader context of cellular networks and regulatory systems. Implement genome-scale metabolic models (GEMs) incorporating YLR123C and its interactors, using flux balance analysis to predict metabolic consequences of YLR123C perturbation. Construct protein-protein interaction networks centered on YLR123C using both experimental data and computational predictions, then analyze network topology to identify critical nodes and potential functional modules.

Develop dynamic models using ordinary differential equations to capture temporal aspects of YLR123C activity and regulation, incorporating time-course experimental data for model training and validation. Implement ensemble modeling approaches that can account for uncertainty in parameters and network structure. For multi-omics integration, use Bayesian network approaches to infer causal relationships between YLR123C and other cellular components across transcriptomic, proteomic, and metabolomic datasets.

Present systems-level insights using network visualizations with YLR123C highlighted as a focal point, showing direct and indirect interactions color-coded by confidence level and interaction type. Supplement with tables summarizing predicted functions and pathway associations derived from computational models. This systems approach moves beyond isolated characterization to understanding YLR123C's role within the complex cellular machinery of S. cerevisiae, potentially revealing emergent properties not obvious from reductionist approaches.

What are the best techniques for studying the evolutionary conservation of YLR123C function?

Studying evolutionary conservation of YLR123C function requires a comprehensive approach combining phylogenetic analysis with functional characterization across species. Begin with detailed sequence analysis by identifying orthologs across yeast species (Saccharomyces, Candida, Schizosaccharomyces) and other fungi using reciprocal BLAST searches and synteny analysis. Construct phylogenetic trees using maximum likelihood or Bayesian methods to visualize evolutionary relationships and identify potential functional divergence events.

Perform detailed sequence analysis to identify conserved domains, motifs, and residues that may be critical for function. Implement evolutionary rate analysis (dN/dS ratios) to identify regions under positive or purifying selection. For functional conservation testing, create chimeric proteins by swapping domains between YLR123C and its orthologs from different species, then test functionality in S. cerevisiae.

Complement sequence analysis with heterologous expression studies by expressing orthologs from different species in a S. cerevisiae ΔYLR123C strain and assessing functional complementation. For deeper insight, perform comparative transcriptomics across species in response to ortholog deletion to identify conserved and divergent gene expression responses.

Present evolutionary analysis in a comprehensive figure showing phylogenetic relationships, sequence conservation heat maps highlighting functional domains, and tables summarizing cross-species complementation results. This evolutionary perspective provides insight into YLR123C's fundamental biological importance and potential specialized adaptations across fungal lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.