Saccharomyces cerevisiae, commonly known as baker's yeast, serves as one of the most extensively studied eukaryotic model organisms in molecular biology. Despite decades of research, numerous genes and their corresponding protein products remain functionally uncharacterized. The genome of S. cerevisiae contains several open reading frames (ORFs) whose functions have not been fully elucidated, with YLR169W being one such example.
YLR169W is classified as a putative uncharacterized protein identified in the Saccharomyces cerevisiae genome. The designation "YLR169W" follows the standard yeast gene nomenclature, where "Y" indicates a yeast gene, "L" represents the chromosome location (in this case, chromosome XII), "R" indicates the right arm of the chromosome, "169" is the relative position, and "W" denotes that it is transcribed from the Watson (5' to 3') strand . The protein is documented in the UniProt database with the identifier O13561, confirming its recognition as a distinct protein entity within the yeast proteome .
YLR169W is a relatively small protein consisting of 117 amino acids in its full-length form. The complete amino acid sequence has been determined as: "MLKFKNMYITSHDNFIAYIFFTFFTFIPFYRSDQSTLCRCSQKIFLSGQRLLRQTVIIVGPLAPFSSYSSPFFFIPLFFSGPNSIPFQDYRCSPWCPSRSHGAVLPSYCSLRWSHRT" . This sequence information is crucial for researchers investigating potential structural motifs, functional domains, or evolutionary relationships.
For research applications, YLR169W has been successfully expressed as a recombinant protein in Escherichia coli expression systems . This heterologous expression approach typically involves cloning the YLR169W gene into an appropriate expression vector, transforming it into a bacterial host, and inducing protein expression. The recombinant protein is produced with an N-terminal histidine tag (His-tag), which facilitates purification through affinity chromatography techniques .
Recombinant YLR169W provides researchers with a valuable tool for investigating protein function in Saccharomyces cerevisiae. As an uncharacterized protein, it represents an opportunity for novel discoveries in yeast biology. Researchers can utilize the purified protein for various experimental approaches, including:
Protein-protein interaction studies to identify binding partners
Functional assays to determine enzymatic activities
Localization studies to determine subcellular distribution
Structural biology investigations to elucidate three-dimensional conformation
The availability of recombinant YLR169W enables the production of specific antibodies against this protein . These antibodies serve as powerful tools for detecting and studying the native protein in yeast cells. Commercial antibodies against YLR169W are available for research applications, further facilitating investigations into this uncharacterized protein .
YLR169W exists within a broader context of uncharacterized proteins in Saccharomyces cerevisiae. Comprehensive studies comparing YLR169W with other uncharacterized proteins, such as YLR171W, YLR444C, and various other YLR family proteins, may reveal patterns of evolutionary relationships or functional similarities . Such comparative analyses could potentially accelerate the functional characterization of multiple proteins simultaneously.
Despite the availability of recombinant YLR169W and related research tools, significant challenges remain in determining its biological function. The "uncharacterized" designation highlights the current gaps in understanding regarding its role in yeast cellular processes. The relatively small size of the protein (117 amino acids) may present challenges for certain structural biology techniques, potentially requiring specialized approaches for functional elucidation.
Recent advancements in proteomics, bioinformatics, and high-throughput screening methodologies offer promising avenues for characterizing previously uncharacterized proteins like YLR169W. Techniques such as:
CRISPR-Cas9 gene editing for generating knockout strains
Proximity-dependent biotin labeling for identifying interaction partners
Computational prediction of protein function based on sequence analysis
High-resolution microscopy for subcellular localization studies
These approaches could collectively contribute to uncovering the biological significance of YLR169W in yeast cells.
YLR169W is a putative uncharacterized protein from the yeast Saccharomyces cerevisiae. It is a small protein consisting of 117 amino acids that has been identified through genomic analysis but whose precise biological function remains to be fully elucidated . The protein has been successfully expressed recombinantly with an N-terminal His-tag in E. coli expression systems, facilitating its purification and subsequent study . Like many uncharacterized proteins (also known as uPE1 proteins in human proteomics), YLR169W represents an important target for functional annotation efforts in the broader context of comprehensive proteome characterization .
Recombinant YLR169W appears to be somewhat sensitive to repeated freeze-thaw cycles, which can compromise its structural integrity and functionality. For optimal stability, the protein should be stored as aliquots at -20°C or preferably -80°C for long-term storage . Working aliquots can be maintained at 4°C for approximately one week without significant degradation . The addition of 5-50% glycerol (with 50% being recommended as a default concentration) serves as a cryoprotectant and helps maintain protein stability during freeze-thaw processes . Researchers should carefully monitor protein stability through activity assays or structural analysis methods when establishing storage protocols for their specific experimental conditions.
For optimal reconstitution of lyophilized YLR169W protein, follow this methodological approach:
Briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom of the container
Reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)
Create multiple small-volume aliquots to minimize freeze-thaw cycles
Store aliquots at -20°C or preferably -80°C for long-term storage
This protocol helps maintain protein stability and functionality by minimizing exposure to conditions that promote denaturation or aggregation. The Tris/PBS-based buffer with 6% trehalose at pH 8.0 used in the commercial preparation provides an optimal environment for protein stability .
While YLR169W is naturally found in S. cerevisiae, E. coli has proven to be an effective heterologous expression system for producing recombinant forms of this protein . The use of E. coli offers several advantages:
Rapid growth and high protein yields
Well-established protocols for induction and purification
Compatibility with N-terminal His-tagging for affinity purification
Cost-effectiveness compared to yeast or mammalian expression systems
Multiple complementary approaches can be employed to predict the function of uncharacterized proteins like YLR169W:
Sequence analysis and homology modeling: Comparing the protein sequence with characterized proteins to identify functional domains and evolutionary relationships
Protein interaction analysis: Affinity purification-mass spectrometry (AP-MS) experiments can reveal protein interaction partners that may provide clues to function. This approach has been successfully used in BioPlex 2.0 database for human uncharacterized proteins
Co-expression network analysis: Identifying genes/proteins that show similar expression patterns across conditions, suggesting functional relationships
Structural prediction: Using computational tools to predict 3D structures that may reveal functional sites
Phenotypic analysis: Studying the effects of gene deletion or overexpression on cellular phenotypes
As demonstrated in human proteome studies, a combined approach using multiple data types can significantly reduce the percentage of uncharacterized proteins in a proteome, from 13% to 6% in recent human proteome studies .
Contradictory findings regarding proteins like YLR169W can be systematically analyzed using the following methodology:
Context-based contradiction analysis: Identify whether contradictions arise from differences in experimental context, such as:
Semantic predication analysis: Utilize subject-relation-object triples to formalize contradictory claims, categorizing relations into excitatory, inhibitory, or other types
Contradiction classification: Categorize contradictions into specific types based on relation patterns, such as:
Automated text analysis: Apply natural language processing techniques to extract claims from the literature and flag potentially contradictory findings
This methodical approach can help researchers identify whether apparent contradictions represent genuine biological phenomena or are artifacts of experimental design or reporting inconsistencies.
Based on systematic analyses of biomedical literature, contradictions in studies of uncharacterized proteins like YLR169W typically stem from several key factors:
Underspecified experimental context: Different experimental conditions not fully reported in publications
Species differences: Variations in protein function or expression between different strains or species
Temporal context variations: Different developmental stages or time points in experiments
Environmental phenomena: Variations in temperature, pH, or other environmental conditions
Natural language processing errors: Automated extraction of claims from literature may introduce false contradictions
Lexical variability: The same protein being referred to by different names or identifiers
Inference and uncertainty: Different degrees of certainty in reporting findings or different inferential leaps from data
A methodical approach to resolving these contradictions involves careful normalization of claims and systematic consideration of contextual factors that may explain apparent discrepancies.
While the specific function of YLR169W remains uncharacterized, its potential role in DNA repair can be considered in the context of other yeast proteins involved in similar processes. For instance, the Rev7 protein in S. cerevisiae has been established as a component of the translesion DNA synthesis polymerase zeta (Polζ) complex, which plays critical roles in DNA damage tolerance and mutagenesis .
Research on Rev7 has shown that:
It enhances the catalytic efficiency of the Rev3 subunit by twenty-to thirtyfold
Strains with mutations in components of the Polζ complex show greatly reduced spontaneous mutation frequencies
While there is no direct evidence linking YLR169W to these processes, researchers could investigate potential interactions between YLR169W and known components of DNA repair pathways to determine if it might play a role in DNA damage response or genome stability maintenance. This could involve targeted protein-protein interaction studies, genetic interaction screens, or phenotypic analysis of YLR169W deletion strains under conditions of DNA damage.
Determining the subcellular localization of YLR169W can provide valuable clues about its function. Several complementary experimental approaches can be employed:
Fluorescent protein tagging: Fusion of YLR169W with GFP or other fluorescent proteins for live-cell imaging
Immunofluorescence microscopy: Using antibodies against the His-tag or the protein itself for fixed-cell localization studies
Subcellular fractionation: Biochemical separation of cellular compartments followed by Western blotting to detect YLR169W
Proximity labeling: Using techniques like BioID or APEX to identify proteins in close proximity to YLR169W within cells
Co-localization studies: Simultaneous visualization of YLR169W with known markers of cellular compartments
These approaches should be conducted under various growth conditions and stress responses to determine if localization is dynamic and responsive to cellular state.
A comprehensive strategy for exploring protein-protein interactions of YLR169W would include these methodological approaches:
| Technique | Advantages | Limitations | Data Output |
|---|---|---|---|
| Affinity Purification-Mass Spectrometry (AP-MS) | Identifies multiple interaction partners in near-native conditions | May miss transient interactions | List of potential interacting proteins with confidence scores |
| Yeast Two-Hybrid (Y2H) | Detects direct binary interactions | High false positive rate | Binary interaction data |
| Proximity-Dependent Biotin Identification (BioID) | Captures transient interactions in native cellular context | Requires fusion protein expression | Proteins in spatial proximity |
| Cross-Linking Mass Spectrometry (XL-MS) | Provides structural information about interaction interfaces | Technically challenging | Cross-linked peptide pairs with distance constraints |
| Co-Immunoprecipitation (Co-IP) | Validates specific interactions | Limited to antibody availability | Confirmation of specific interactions |
A multi-method approach combining these techniques would provide the most robust dataset for constructing a protein interaction network centered on YLR169W. Computational analysis of this network could then reveal potential functional modules and biological processes involving this uncharacterized protein.
Emerging computational approaches for functional prediction of uncharacterized proteins like YLR169W include:
Deep learning models: Neural networks trained on multiple data types (sequence, structure, interaction data) to predict protein function
Evolutionary coupling analysis: Identifying co-evolving residues across species to infer structural contacts and functional domains
Protein language models: Treating protein sequences as a language to identify functional patterns and relationships
Network-based inference: Using protein-protein interaction networks to predict function based on the "guilt by association" principle
Multi-omics data integration: Combining proteomics, transcriptomics, and metabolomics data to build comprehensive functional models
These computational approaches, when combined with targeted experimental validation, represent a promising pathway for reducing the number of uncharacterized proteins in the yeast proteome, similar to efforts that have reduced human uPE1 proteins from 13% to 6% of the proteome .
The characterization of YLR169W has potential implications that extend beyond yeast biology to broader eukaryotic cellular processes:
YLR169W may represent a member of a previously unrecognized protein family with conserved functions across eukaryotes
Understanding its role could provide insights into fundamental cellular processes that are conserved from yeast to humans
As demonstrated with translesion DNA synthesis polymerases, proteins first characterized in yeast often have homologs involved in critical processes in human cells, including disease mechanisms
The methodologies developed for characterizing YLR169W could serve as a template for functional annotation of other uncharacterized proteins across species
Systematic efforts to characterize proteins like YLR169W contribute to the comprehensive understanding of proteomes, analogous to the Human Proteome Project's efforts to register and functionally annotate all human proteins .