Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR198C (YLR198C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development for your order.
Synonyms
YLR198C; Putative uncharacterized protein YLR198C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YLR198C
Target Protein Sequence
MGYTLFRFIVPFNPYFSSFYPSFPFYLSFPFCPSFPSFLSFPSSIFSLSFPSFLHHHLLI FSSLRIPFPWFLPLLQLVYLCYKVPWLLEWLIHSSKLAYQCCRILIFAQLVSLVRNQKH
Uniprot No.

Target Background

Database Links

STRING: 4932.YLR198C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YLR198C and what is currently known about its function in Saccharomyces cerevisiae?

YLR198C is a putative uncharacterized protein in Saccharomyces cerevisiae with a full length of 119 amino acids . As an uncharacterized protein, its specific biological function remains largely undefined. The protein can be produced as a recombinant protein with a His-tag in E. coli expression systems .

The limited knowledge about YLR198C's function makes it an excellent candidate for functional genomics studies. Current research approaches follow similar methodologies used for other uncharacterized yeast proteins, such as YTA6 and YPR096C, which were found to influence cell sensitivity to lithium chloride when galactose is used as a carbon source .

What expression systems are most effective for producing recombinant YLR198C protein?

For expressing recombinant YLR198C, two primary expression systems can be considered:

E. coli expression system:

  • Advantages: High yield, cost-effective, well-established protocols

  • Protocol: The YLR198C gene can be cloned into an expression vector with a His-tag, expressed in E. coli, and purified using affinity chromatography

  • Considerations: May lack proper eukaryotic post-translational modifications

S. cerevisiae expression system:

  • Advantages: Native post-translational modifications, proper protein folding

  • Protocol: The gene can be cloned into yeast expression vectors such as pYES2 under the control of promoters like GAL1

  • Expression can be induced using galactose when using the GAL1 promoter

  • Purification via affinity tags such as His-tag

Expression and purification protocol comparison:

ParameterE. coli SystemS. cerevisiae System
YieldHigh (mg/L)Moderate (μg-mg/L)
Post-translational modificationsLimitedNative
Expression time4-6 hours24-48 hours
Induction methodIPTGGalactose
CostLowModerate
Purification methodNi-NTA affinityNi-NTA affinity

How can gene knockout technology be implemented to study YLR198C function?

Gene knockout studies are vital for understanding the function of uncharacterized proteins like YLR198C. The methodology typically employs homologous recombination in yeast:

Protocol for YLR198C deletion:

  • Design primers with 40-50bp homology to regions flanking YLR198C and 20bp homology to a selectable marker (e.g., kanMX4)

  • Amplify the deletion cassette by PCR

  • Transform yeast cells using lithium acetate method:

    • Harvest cells at 1-2 x 10^7 cells/mL (OD600 of 1:10 dilution = 0.1-0.2)

    • Resuspend cells in 100mM lithium acetate

    • Add the PCR product, carrier DNA, and PEG solution

    • Heat shock at 42°C for 40 minutes

    • Plate on selective media

  • Verify gene deletion by PCR and/or phenotypic analysis

  • Compare growth and phenotypic characteristics of the knockout strain with wild-type under various conditions

This approach allows researchers to observe phenotypic changes resulting from the absence of YLR198C, providing insights into its potential function.

What bioinformatic approaches can predict potential functions of YLR198C?

For uncharacterized proteins like YLR198C, bioinformatic analyses provide crucial initial insights:

Sequence-based analyses:

  • Homology searches using BLASTP against protein databases

  • Multiple sequence alignment with potential homologs

  • Identification of conserved domains using Pfam, SMART, or InterPro

  • Prediction of secondary structure elements

Structural analyses:

  • 3D structure prediction using AlphaFold or I-TASSER

  • Structural alignment with proteins of known function

  • Identification of potential binding sites or catalytic residues

Genomic context analyses:

  • Gene neighborhood analysis in related species

  • Gene co-expression patterns in transcriptomic datasets

  • Synthetic genetic interaction networks

Recommended workflow:

  • Perform sequence-based analyses to identify conserved domains

  • Generate structural predictions to identify potential functional sites

  • Analyze genomic context for functional associations

  • Integrate all predictions to develop testable hypotheses about YLR198C function

What phenotypic screening approaches can identify potential functions of YLR198C?

Comprehensive phenotypic screening of YLR198C mutants can reveal its functional role:

Growth-based phenotypic screens:

  • Test growth on different carbon sources (glucose, galactose, glycerol)

  • Assess sensitivity to various stressors (temperature, pH, osmotic stress)

  • Screen for sensitivity to specific chemicals or drugs

  • Examine growth in the presence of lithium chloride, which has been informative for other uncharacterized yeast proteins

Enzymatic activity screening:
Similar to approaches used for other yeast proteins, screen YLR198C for common enzymatic activities:

  • Polygalacturonase activity: Plate on polygalacturonate agar medium, stain with 0.1% ruthenium red to detect activity

  • Protease activity: Plate on media containing 2% skim milk powder and look for clear zones

  • β-Glucosidase activity: Plate on media containing cellobiose and ammonium ferric citrate, look for brown discoloration

  • Cellulase activity: Plate on YPGE with carboxymethylcellulose, stain with Coomassie Brilliant Blue

Cellular localization:

  • Express YLR198C-GFP fusion protein to determine subcellular localization

  • Compare localization under different growth conditions or stressors

Recommended experimental matrix:

Condition CategorySpecific ConditionsMeasurements
Carbon sourcesGlucose, galactose, glycerol, ethanolGrowth rate, gene expression
Chemical stressorsLiCl, H₂O₂, heavy metals, antifungalsSurvival rate, morphology
Environmental stressesHeat, cold, pH, osmotic pressureStress response genes, growth
Nutrient limitationNitrogen, phosphate, amino acid starvationMetabolic adaptations

How can synthetic genetic array (SGA) analysis be used to map the genetic interaction network of YLR198C?

SGA analysis provides a powerful approach to understand the functional context of YLR198C through its genetic interactions:

SGA methodology for YLR198C:

  • Create a query strain with YLR198C deletion marked with a selectable marker (e.g., natMX4)

  • Cross this strain with an ordered array of yeast deletion mutants (each marked with kanMX4)

  • Select diploids on media containing both markers

  • Induce sporulation of diploids

  • Select for haploid double mutants through a series of selection steps

  • Score growth of double mutants compared to single mutants

  • Identify synthetic lethal, synthetic sick, or epistatic interactions

Data analysis:

  • Calculate genetic interaction scores (ε) as the difference between observed and expected double mutant fitness

  • Construct a genetic interaction network with YLR198C

  • Perform enrichment analysis of interacting genes for functional categories

  • Compare the YLR198C interaction profile with profiles of known genes to identify functional similarities

Interpretation framework:

  • Negative genetic interactions (synthetic sickness/lethality) suggest parallel or redundant pathways

  • Positive genetic interactions suggest functions in the same pathway or complex

  • Clusters of interacting genes may indicate biological processes involving YLR198C

This approach has been successfully used for characterizing uncharacterized proteins and can provide valuable insights into the functional relationships of YLR198C.

What approaches are recommended for studying potential post-translational modifications of YLR198C?

Post-translational modifications (PTMs) can significantly influence protein function. For YLR198C, a comprehensive analysis includes:

Identification of potential PTMs:

  • Mass spectrometry-based proteomics:

    • Express and purify tagged YLR198C from yeast

    • Perform tryptic digestion followed by LC-MS/MS analysis

    • Analyze data using PTM identification algorithms

  • Prediction of modification sites:

    • Use computational tools to predict phosphorylation, ubiquitination, or SUMOylation sites

    • Compare with conserved modification sites in homologs if available

    • Focus on sites conserved across related yeast species

Functional characterization of PTMs:

  • Site-directed mutagenesis:

    • Generate point mutations at predicted modification sites

    • Express mutant proteins in yeast lacking the endogenous YLR198C

    • Assess phenotypic consequences of mutations

  • PTM-specific detection:

    • Develop or use antibodies specific to the modified form of YLR198C

    • Monitor modification status under different conditions

    • Examine the relationship between modification state and function

Research on other yeast proteins suggests that sumoylation may act as a conserved negative regulator of cell cycle-regulated gene transcription . If YLR198C is involved in similar processes, investigating sumoylation could be particularly informative.

How can researchers resolve contradictory data in YLR198C functional studies?

When facing contradictory results in YLR198C studies, a systematic troubleshooting approach is essential:

Methodological reconciliation steps:

  • Examine experimental variables:

    • Compare strain backgrounds used (genomic context may affect function)

    • Review growth conditions and media compositions

    • Analyze experimental timing and sampling methods

  • Statistical reassessment:

    • Evaluate statistical methods used in different studies

    • Consider sample sizes and statistical power

    • Re-analyze raw data when possible using consistent statistical approaches

  • Design decisive experiments:

    • Develop experiments specifically targeting the contradictions

    • Include appropriate controls for all variables

    • Implement blinded analysis to reduce bias

Collaborative resolution framework:

  • Direct replication attempts involving multiple laboratories

  • Standardized protocols shared between research groups

  • Open data sharing and collaborative analysis

When analyzing contradictory data, remember that Saccharomyces cerevisiae is highly adaptable, and protein functions may be context-dependent . The contradictions may reveal condition-specific functions of YLR198C rather than experimental errors.

What experimental design principles should be applied to YLR198C studies to ensure reproducibility?

Robust experimental design is crucial for reliable YLR198C research. Key considerations include:

Variable definition and control:

  • Clearly define independent variables (e.g., YLR198C presence/absence, expression level)

  • Identify dependent variables (e.g., growth rate, stress response)

  • Control extraneous variables (strain background, media composition, environmental conditions)

Experimental controls:

  • Include appropriate positive and negative controls for each experiment

  • Use isogenic strains differing only in YLR198C status

  • Include wild-type references and empty vector controls

Statistical considerations:

  • Determine sample sizes based on power analysis

  • Plan for biological and technical replicates

  • Pre-specify statistical analysis methods

Experimental design matrix example:

Research QuestionExperimental ApproachControlsReplicationAnalysis Method
Function identificationPhenotypic screeningWT strain, known mutants3 biological, 3 technicalANOVA with post-hoc tests
LocalizationYLR198C-GFP fusionGFP-only control100+ cells per conditionQuantitative image analysis
Protein interactionsCo-IP/Mass specMock IP, random protein3 biological replicatesSignificance analysis of interactome
Gene regulationRNA-seq after deletionWT, vector-only3 biological replicatesDESeq2 differential expression

Following these design principles helps ensure that findings regarding YLR198C are robust and reproducible across different research settings.

How can advanced crossing designs and synthetic recombinant populations be used to study YLR198C function in diverse genetic backgrounds?

Understanding YLR198C function across genetic backgrounds provides deeper insights into its biological role:

Crossing design approaches:
Two main approaches can be used to create synthetic recombinant populations, as described in research on yeast genetic diversity :

  • "K-type" approach:

    • Mix multiple haploid strains and allow random mating

    • Simple to implement but may result in uneven founder representation

  • "S-type" approach:

    • Pair strains of opposite mating types for controlled crosses

    • Dissect tetrads to obtain meiotic products

    • More labor-intensive but produces populations with more equal founder representation

Protocol for S-type population construction with YLR198C variants:

  • Create YLR198C variants in different strain backgrounds

  • Pair strains of opposite mating types

  • Select successful diploid colonies

  • Induce sporulation in 1% potassium acetate for 72h at 30°C

  • Dissect tetrads to collect spores

  • Allow mating and collect diploids

Applications for YLR198C research:

  • Examine how genetic background influences YLR198C function

  • Identify modifier genes that interact with YLR198C

  • Map quantitative trait loci (QTLs) that affect YLR198C-dependent phenotypes

  • Create diverse strain collections for robust functional testing

This approach is particularly valuable for uncharacterized proteins like YLR198C, as it helps distinguish core functions from strain-specific effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.