Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR279W (YLR279W)

Shipped with Ice Packs
In Stock

Description

General Information

YLR279W is a protein encoded by an open reading frame (ORF) in Saccharomyces cerevisiae. Many ORFs in S. cerevisiae lack characterized sequences or protein structures, making it difficult to deduce their biological functions using traditional sequence-based approaches .

Functional Analysis of Uncharacterized Proteins

Traditional methods are not enough to understand the roles of uncharacterized ORFs . Studies employ various techniques to explore the functions of these proteins, including:

  • Gene Expression Analysis: Monitoring gene expression patterns under different conditions can provide clues about a protein's function. For example, if a gene is highly induced under stress conditions, it may be involved in stress response .

  • Phenotype Screening: Deleting a gene and observing the resulting phenotypic changes can reveal its role in cellular processes .

  • Protein Localization: Determining the cellular location of a protein can provide insights into its function .

  • Structural Analysis: Determining the three-dimensional structure of a protein can help identify potential functional domains and predict its biochemical activity .

Saccharomyces cerevisiae as a Model Organism

Saccharomyces cerevisiae serves as a model organism to extrapolate results to other organisms because many of its biological pathways are similar to those of other eukaryotes . Proteome comparisons between S. cerevisiae and other organisms help identify pathways and processes for which S. cerevisiae serves as a good model .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customer use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
YLR279W; L8003.10A; Putative uncharacterized protein YLR279W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YLR279W
Target Protein Sequence
MRFRSQRAVCRSRNYSMYCCSRVFVRNPRLDRRYPQVKILAKLHFFFHFFFSFLLHLISP AVTGGITRAPFLCLGPRVPLFRLERPLHAARTSRRCAGAASVSVDGATVEAPPLWTASCR TTPQVRARA
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression patterns have been observed for YLR279W?

According to the Saccharomyces Genome Database, there is currently no expression data available for YLR279W . This absence of expression data could indicate several possibilities:

  • The gene may be expressed at very low levels under standard laboratory conditions

  • Expression might be induced only under specific environmental conditions or stress responses

  • The gene may be subject to complex temporal or spatial regulation

To investigate YLR279W expression patterns, researchers should consider:

  • RT-qPCR analysis under various growth conditions and stress responses

  • RNA-seq analysis to detect transcripts across different conditions

  • Reporter gene assays using the YLR279W promoter region

  • Proteomics approaches with highly sensitive mass spectrometry

A systematic analysis across different conditions would help establish when and where YLR279W is expressed, providing valuable clues about its potential function.

What are effective methods for expressing and purifying recombinant YLR279W?

Based on available research data, the following approaches have proven effective for recombinant YLR279W production:

Expression system: E. coli has been successfully used for YLR279W expression with an N-terminal His-tag fusion .

Purification protocol:

  • Express the His-tagged protein in an appropriate E. coli strain (e.g., BL21(DE3))

  • Lyse cells under native conditions

  • Purify using Ni-NTA affinity chromatography

  • Store in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

Storage recommendations:

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

  • Store at -20°C/-80°C in small aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be maintained at 4°C for up to one week

For researchers requiring higher yields or alternative approaches, optimization experiments comparing different expression vectors, host strains, induction conditions, and purification strategies would be beneficial.

How can I design a synthetic genetic array (SGA) screening to study YLR279W interactions?

Synthetic genetic array (SGA) screening is a powerful approach to identify genetic interactions. Based on established methodologies, the following protocol can be adapted for YLR279W:

  • Create a query strain:

    • Generate a YLR279W deletion or mutant strain in an appropriate background (typically MATα)

    • Ensure the strain contains suitable selectable markers (e.g., can1Δ::STE-pr-HIS5 as described in the literature)

  • Perform systematic crosses:

    • Cross the query strain with the yeast knockout (YKO) collection containing deletions of all non-essential genes

    • The basic mating procedure follows established SGA protocols

  • Select double mutants:

    • Use sequential replica plating onto selective media to isolate haploid double mutants containing both the YLR279W mutation and a deletion from the YKO collection

    • Follow selection steps similar to those described for other SGA screens

  • Analyze growth phenotypes:

    • Score colony size and growth characteristics to identify synthetic lethal, synthetic sick, or suppressor interactions

    • Image analysis software such as ImageJ with appropriate plugins can be used for quantification

  • Validate interactions:

    • Confirm key interactions through tetrad analysis or direct construction of double mutants

    • Perform additional phenotypic assays to characterize the nature of interactions

This approach will help identify genes that functionally interact with YLR279W, providing insights into its biological role and the pathways it participates in.

What microscopy techniques are most suitable for studying YLR279W in yeast cells?

Several microscopy techniques are applicable for investigating YLR279W localization and dynamics:

Electron microscopy:

  • Prepare samples by immersing yeast cells in liquid propane at -180°C

  • Fix with 4% osmium tetroxide in dry acetone at -82°C for 72h

  • Warm progressively to room temperature and stain with uranyl acetate and lead citrate

  • This provides high-resolution ultrastructural data that can reveal subcellular localization

Fluorescence microscopy:

  • Generate a YLR279W-GFP fusion construct for live cell imaging

  • Analyze localization patterns under different conditions and time points

  • Co-localize with known organelle markers to determine subcellular distribution

  • Flow cytometry can complement microscopy for quantitative analysis

Live-cell imaging:

  • For studying protein dynamics, time-lapse fluorescence microscopy with GFP-tagged YLR279W

  • This approach can reveal temporal changes in localization or abundance

Super-resolution techniques:

  • Techniques such as STORM, PALM, or SIM provide higher spatial resolution (20-100nm)

  • Particularly valuable if YLR279W forms discrete structures or localizes to specific cellular regions

Each approach offers different advantages depending on whether the research question focuses on localization, dynamics, interactions, or structural roles of YLR279W.

How can genome-wide screens be utilized to investigate YLR279W function?

Genome-wide screens provide powerful approaches to elucidate the function of uncharacterized proteins like YLR279W:

Deletion phenotyping:

  • Analyze the phenotype of YLR279W deletion in a comprehensive range of conditions

  • Compare growth, morphology, and stress responses to the wild-type strain

  • Screen for condition-specific phenotypes that may reveal specialized functions

Synthetic genetic array (SGA) analysis:

  • As described in section 2.2, SGA screening can identify genetic interactions

  • Genetic interaction networks often reveal functional relationships

  • Clustering of genetic interaction profiles can place YLR279W in a functional context

High-throughput localization studies:

  • Systematic GFP-tagging to determine subcellular localization

  • Changes in localization under different conditions may indicate function

Transcriptome analysis:

  • RNA-seq comparing wild-type and YLR279W deletion strains

  • Identify genes whose expression is altered by YLR279W deletion

  • Gene set enrichment analysis to identify affected pathways

Multi-omics integration:

  • Combine data from genetic, proteomic, and phenotypic screens

  • Computational integration can reveal hidden functional relationships

  • Network analysis to position YLR279W within cellular pathways

These approaches have been successfully applied to characterize previously uncharacterized yeast genes and can be adapted specifically for YLR279W functional studies.

What phenotypes might be associated with YLR279W deletion or overexpression?

While specific phenotypes associated with YLR279W manipulation have not been extensively characterized in the literature, a systematic approach to phenotypic analysis should include:

Growth condition testing:

  • Evaluate growth on different carbon sources (glucose, galactose, glycerol, ethanol)

  • Test temperature sensitivity (15°C, 30°C, 37°C, 39°C)

  • Examine response to osmotic stress (high salt, sorbitol)

  • Assess sensitivity to cell wall stressors (calcofluor white, Congo red)

  • Screen for sensitivity to DNA damaging agents (UV, MMS, hydroxyurea)

Cell morphology analysis:

  • Microscopic examination of cell size, shape, and budding patterns

  • Staining of specific cellular structures (cell wall, vacuole, mitochondria)

  • Assessment of cellular aggregation or flocculation

Cell cycle analysis:

  • Flow cytometry after DNA staining to detect cell cycle abnormalities

  • Budding index determination

Stress response evaluation:

  • Oxidative stress resistance (hydrogen peroxide, menadione)

  • ER stress response (tunicamycin, DTT)

  • Protein homeostasis (heat shock, proteasome inhibitors)

Long-term fitness effects:

  • Competitive growth assays against wild-type strains

  • Chronological and replicative lifespan measurements

  • Evolution experiments to detect adaptive responses

A comprehensive phenotypic analysis across these conditions would help place YLR279W in a functional context, even in the absence of obvious phenotypes under standard laboratory conditions.

What can long-term evolution experiments reveal about YLR279W function?

Long-term evolution experiments (LTEEs) provide powerful insights into gene function by observing evolutionary trajectories over thousands of generations. For YLR279W, this approach could be particularly valuable:

Experimental design:

  • Propagate parallel populations of wild-type and YLR279W deletion strains under various selection pressures

  • Maintain cultures through serial transfers for thousands of generations

  • Preserve fossil records by freezing samples at regular intervals

Analytical approaches:

  • Compare fitness trajectories between wild-type and YLR279W deletion lineages

  • Sequence evolved populations to identify compensatory or adaptive mutations

  • Analyze the rate and spectrum of mutations in different genetic backgrounds

  • Perform competition assays between ancestral and evolved strains

Expected insights:

  • If YLR279W deletion strains consistently evolve differently than wild-type, this suggests functional importance

  • Compensatory mutations that arise in YLR279W deletion strains may identify functional pathways

  • Environment-specific differences in evolution can reveal condition-dependent roles

  • Convergent evolution across replicate populations would highlight strong selection pressures

This approach extends beyond simple phenotypic characterization to reveal the long-term consequences of YLR279W function or loss, potentially uncovering subtle but important roles that might be missed in short-term experiments .

How should researchers approach comparative analysis of YLR279W across yeast species?

Comparative analysis across species can provide valuable evolutionary context for understanding YLR279W function:

Ortholog identification:

  • Use sequence similarity searches (BLAST, HMMer) to identify potential orthologs

  • Confirm orthology through reciprocal best hit analysis and synteny examination

  • Distinguish between orthologs (same function) and paralogs (potential functional divergence)

Sequence conservation analysis:

  • Align sequences of identified orthologs to determine conservation patterns

  • Identify highly conserved regions that likely represent functional domains

  • Calculate selection pressure (dN/dS ratios) to detect signatures of purifying or positive selection

Functional complementation:

  • Test whether orthologs from other species can complement YLR279W deletion in S. cerevisiae

  • Cross-species functional rescue provides strong evidence for functional conservation

Expression pattern comparison:

  • Compare expression profiles of orthologs across species when possible

  • Conservation of regulation may indicate conserved function

  • Divergent expression patterns may suggest functional specialization

Structural prediction:

  • Use comparative modeling to predict structures based on conserved features

  • Identify potential binding sites or catalytic residues

This comparative approach places YLR279W in an evolutionary context and can reveal functional constraints that have shaped its evolution, providing clues about its biological importance.

How should researchers interpret negative results in YLR279W functional studies?

Negative results in YLR279W studies require careful interpretation and may still provide valuable information:

Consider condition-specificity:

  • YLR279W may function only under specific environmental conditions

  • Systematic testing across diverse conditions may reveal cryptic phenotypes

  • Stress conditions often unmask phenotypes not evident under standard conditions

Evaluate potential redundancy:

  • Functional overlap with other genes may mask phenotypes in single deletion strains

  • Consider creating double or triple mutants with genes of similar sequence or predicted function

  • Use synthetic genetic array (SGA) analysis to identify compensation patterns

Assess experimental sensitivity:

  • The effect of YLR279W may be subtle and require sensitive detection methods

  • Increase statistical power through additional replicates

  • Consider competitive growth assays that can detect small fitness differences

Re-evaluate experimental hypotheses:

  • Initial hypotheses about YLR279W function may need revision

  • Use negative results to refine hypotheses and direct new investigations

  • Integrate negative results with positive findings from other approaches

Examine temporal factors:

  • YLR279W may function at specific cell cycle stages or growth phases

  • Time-course experiments may reveal transient phenotypes

Negative results should be documented thoroughly, as they eliminate potential functions and guide future research directions. The absence of a phenotype under specific conditions is itself a valid scientific observation that contributes to understanding YLR279W.

What statistical approaches are appropriate for analyzing YLR279W-related experimental data?

Proper statistical analysis is crucial for making valid inferences about YLR279W function:

For growth phenotype analysis:

  • Analysis of variance (ANOVA) for comparing multiple conditions

  • Appropriate post-hoc tests (e.g., Tukey's HSD) for multiple comparisons

  • Growth curve parameter extraction and comparative analysis

  • Colony size measurement using image analysis software (e.g., ImageJ)

For expression studies:

  • Normalization methods appropriate to the technology used (e.g., RPKM, TPM for RNA-seq)

  • Differential expression analysis with appropriate multiple testing correction

  • GSEA (Gene Set Enrichment Analysis) for pathway-level interpretation

For interaction studies:

  • Statistical significance assessment for protein-protein interactions

  • Network analysis metrics to identify significant interaction patterns

  • Enrichment analysis of interaction partners for functional inference

For evolutionary analyses:

  • Statistical tests for comparing evolutionary rates between lineages

  • Likelihood ratio tests for selection pressure analysis

  • Phylogenetic methods to reconstruct evolutionary history

General statistical considerations:

  • Power analysis to determine appropriate sample sizes

  • Effect size calculations to assess biological significance

  • Multiple testing correction to control false discovery rate

  • Non-parametric alternatives when data violates normality assumptions

Statistical TestApplicationKey Considerations
t-testComparing two conditionsAssumes normal distribution
ANOVAComparing multiple conditionsRequires post-hoc testing for pairwise comparisons
Chi-squareCategorical data analysisRequires sufficient counts in each category
Non-parametric testsWhen normality cannot be assumedWilcoxon, Mann-Whitney U, Kruskal-Wallis
Regression analysisModeling relationships between variablesLinear, logistic, or polynomial depending on data

Transparent reporting of all statistical methods, including specific tests, significance thresholds, and software packages used, is essential for reproducibility in YLR279W research.

How might YLR279W contribute to cellular stress responses?

Although specific information about YLR279W's role in stress responses is limited, several methodological approaches can address this question:

Stress sensitivity profiling:

  • Compare growth of wild-type and YLR279W deletion strains under various stressors:

    • Oxidative stress (H₂O₂, menadione)

    • Heat shock and temperature extremes

    • Osmotic stress (NaCl, sorbitol)

    • DNA damage (UV, MMS, hydroxyurea)

    • Protein misfolding stress (heat shock, chemical chaperone inhibitors)

  • Quantify growth parameters using automated growth curve analysis

Gene expression analysis:

  • Monitor YLR279W expression levels under different stress conditions

  • Identify stress conditions that specifically induce or repress YLR279W

  • Compare transcriptome-wide responses to stress between wild-type and YLR279W deletion strains

Protein localization dynamics:

  • Track YLR279W-GFP localization before and after stress exposure

  • Changes in localization may indicate stress-specific functions

  • Co-localization with stress granules or processing bodies would suggest roles in RNA metabolism during stress

Protein interaction dynamics:

  • Identify changes in YLR279W interaction partners under stress conditions

  • Affinity purification-mass spectrometry before and after stress exposure

  • Proximity labeling to capture transient stress-induced interactions

These approaches would help determine whether YLR279W plays a role in specific stress responses and provide insights into its potential function under non-standard conditions.

What techniques can reveal the potential involvement of YLR279W in protein-protein interaction networks?

Several complementary techniques can elucidate YLR279W's position within protein interaction networks:

Affinity purification-mass spectrometry (AP-MS):

  • Tag YLR279W with an epitope tag (e.g., TAP, FLAG, HA)

  • Purify YLR279W under native conditions to preserve interactions

  • Identify co-purifying proteins by mass spectrometry

  • Distinguish true interactors from background using appropriate controls

Yeast two-hybrid (Y2H) screening:

  • Use YLR279W as bait against a prey library of yeast proteins

  • Identify direct binary interactions

  • Validate positive hits through secondary assays

Proximity labeling:

  • Fuse YLR279W to a biotin ligase (BioID) or peroxidase (APEX2)

  • Identify proteins in close proximity through biotinylation

  • Particularly useful for detecting transient or weak interactions

Crosslinking mass spectrometry (XL-MS):

  • Use chemical crosslinkers to stabilize protein-protein interactions

  • Identify interaction partners and specific contact sites

  • Provides structural information about interaction interfaces

Genetic interaction mapping:

  • Synthetic genetic array (SGA) analysis as described earlier

  • Functional interactions often correlate with physical interactions

Computational predictions:

  • Use co-expression data, evolutionary conservation, and structural information

  • Integrate with experimental data to build comprehensive interaction networks

  • Predict interactions based on homology to known interacting proteins

Combining multiple approaches provides more reliable interaction data and can help distinguish between stable complex members and transient interaction partners.

What are the key challenges and priorities for future research on YLR279W?

Despite decades of yeast research, proteins like YLR279W remain uncharacterized, presenting both challenges and opportunities for researchers:

Current knowledge gaps:

  • Functional role of YLR279W under standard and stress conditions

  • Subcellular localization and potential dynamic changes

  • Interaction partners and participation in cellular pathways

  • Expression patterns and regulation

  • Evolutionary conservation and importance

Research priorities:

  • Comprehensive phenotypic characterization:

    • Systematic analysis across diverse conditions

    • Sensitive assays to detect subtle phenotypic effects

    • Combined deletion/overexpression approaches

  • Multi-omics integration:

    • Combine transcriptomic, proteomic, and metabolomic data

    • Integrate with genetic interaction networks

    • Use computational approaches to predict function

  • Evolutionary analysis:

    • Comparative studies across yeast species

    • Long-term experimental evolution to reveal selective pressures

    • Population genetic analysis of natural variation

  • Structure-function studies:

    • Determination of three-dimensional structure

    • Identification of functional domains

    • Structure-guided functional predictions

  • Development of tailored assays:

    • Based on bioinformatic predictions and preliminary data

    • Targeted approaches to test specific hypotheses

    • Novel screening methods to identify function

The characterization of previously uncharacterized proteins like YLR279W remains crucial for completing our understanding of cellular systems and may reveal novel biological principles or potential targets for biotechnological applications.

How can researchers integrate findings about YLR279W into broader yeast biology research?

Effectively integrating YLR279W research into the broader context of yeast biology requires:

Data integration and systems biology approaches:

  • Position YLR279W within known cellular networks

  • Use interaction data to infer functional relationships

  • Apply machine learning to predict functions from diverse data types

  • Contribute findings to community databases to facilitate integration

Comparative genomics perspective:

  • Connect YLR279W to its evolutionary context

  • Compare functions across species to identify conserved roles

  • Study natural variation to understand adaptive significance

Contribution to biological knowledge:

  • Determine how YLR279W findings extend current models of cellular processes

  • Identify novel principles that might apply more broadly

  • Develop new experimental paradigms based on discoveries

Translation to applications:

  • Assess biotechnological potential based on function

  • Evaluate as a potential target for antifungal development if conserved in pathogenic fungi

  • Consider as a model for similar uncharacterized proteins in other organisms

Community resource development:

  • Share reagents, strains, and protocols to advance collective knowledge

  • Contribute standardized data to databases

  • Develop and share computational tools for similar analyses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.