Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR294C (YLR294C)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

Recombinant YLR294C is produced in multiple expression systems:

Expression SystemHostTagPuritySource
E. coliBacterialHis-tag>90%
Cell-FreeIn vitroNone≥85%
BaculovirusInsectVariableInquire

Purification typically involves affinity chromatography (e.g., Ni-NTA for His-tagged versions) . Storage recommendations include Tris- or PBS-based buffers with glycerol (50%) at -20°C or -80°C .

Key Uses:

  • Structural Studies: Preliminary sequence analysis suggests potential transmembrane domains, making it a candidate for membrane protein research .

  • Interaction Mapping: Vendors highlight its utility in yeast two-hybrid or co-IP assays to identify binding partners .

  • Antigen Production: ELISA-ready formulations are available, though no peer-reviewed studies validate its immunogenicity .

Limitations:

  • No functional data or pathway associations are documented in SGD or vendor materials .

  • Limited batch-to-batch consistency reports.

Future Research Directions

Critical knowledge gaps include:

  1. Functional Characterization: Enzymatic assays or knockout studies to determine biological roles.

  2. Structural Analysis: X-ray crystallography or Cryo-EM to resolve 3D structure.

  3. Pathway Identification: High-throughput screens to map genetic interactions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YLR294C; L8003.19A; Putative uncharacterized protein YLR294C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YLR294C
Target Protein Sequence
MMLRKPKKVIELFIASSLSKKKQTEPQAEQDHYFWLSSSHLFIFESSTIKKKQNTLRTLC NQPHKMQNLFFKQKIQLYIDTSLSFLLLLFFYFNNYYFLSMTYASLVNK
Uniprot No.

Target Background

Database Links

STRING: 4932.YLR294C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Methodological Research Questions

  • How can researchers clone and express recombinant YLR294C for functional studies?

    Standard yeast molecular cloning techniques can be applied to express recombinant YLR294C. The most common approach involves:

    1. PCR amplification of the YLR294C coding sequence from genomic DNA using specific primers

    2. Insertion into an appropriate expression vector with a selectable marker

    3. Transformation into an expression host (either E. coli for bacterial expression or back into yeast)

    For yeast expression, researchers typically use either constitutive promoters (like TEF2) or inducible systems (like the copper-inducible promoter used in some constructs). As demonstrated in similar yeast protein studies, adding epitope tags (His6, FLAG, etc.) facilitates protein purification and detection . When working with potentially membrane-associated proteins like YLR294C, optimizing solubilization conditions using appropriate detergents may be necessary during extraction and purification phases.

  • How can researchers generate and validate YLR294C deletion mutants?

    The standard approach for generating YLR294C deletion mutants involves:

    1. PCR-based gene replacement using the short flanking homology (SFH) method

    2. Using deletion cassettes containing selectable markers (KanMX4 is commonly used)

    3. Transformation of yeast cells using the lithium acetate method

    4. Selection of transformants on appropriate media containing selective agents

    5. Confirmation of gene deletion by PCR verification

    This methodology has been successfully applied to generate deletion strains throughout the yeast genome, including for studying genes involved in respiration . The gene disruption library, containing a comprehensive collection of yeast deletion strains, includes YLR294C mutants that can be obtained for direct experimentation .

Advanced Research Questions

  • What computational approaches are recommended for predicting YLR294C function?

    Modern computational approaches to predict YLR294C function should include:

    1. Sequence-based methods:

      • Protein domain prediction using tools like InterPro, Pfam

      • Transmembrane topology prediction (TMHMM, Phobius)

      • Signal peptide prediction (SignalP)

    2. Structure-based methods:

      • Ab initio protein structure prediction (e.g., AlphaFold2)

      • Structure-function relationship analysis

    3. System-level analyses:

      • Protein-protein interaction network analysis

      • Gene co-expression analysis across conditions

      • Phenotypic clustering with known genes (as demonstrated in )

      • Evolutionary conservation patterns

    4. Metabolic pathway analysis:

      • Integration with metabolic models

      • Flux balance analysis with/without YLR294C

    These computational approaches can generate testable hypotheses about YLR294C function that direct experimental validation efforts, particularly important for uncharacterized proteins where limited experimental data exists.

  • How should researchers address contradictory results when studying YLR294C?

    When facing contradictory results in YLR294C research, implement this systematic resolution approach:

    1. Verify strain backgrounds: Different S. cerevisiae strains may show varying phenotypes; always document strain provenance (e.g., S288C vs. other laboratory strains) .

    2. Control for growth conditions: Small variations in media composition or growth parameters can significantly impact yeast phenotypes. Document precise environmental conditions including temperature, pH, and media formulations .

    3. Re-examine methodology: Technique standardization is crucial - particularly for phenotypic assays. For instance, contradictions reported in a study by Mühe (2007) regarding growth defects in atg15Δ cells were attributed to methodological differences .

    4. Implement multiple assays: Cross-validate findings using alternative experimental approaches - a principle demonstrated in mitophagy studies where multiple assays yielded complementary insights .

    5. Collaborate and communicate: Share detailed protocols and raw data with collaborators. When publishing contradictory findings, explicitly address methodological differences with previous studies .

    This structured approach mirrors recommendations from the literature on resolving data contradictions in yeast research and should be documented thoroughly to contribute to research reproducibility .

  • What reference gene sets should be used for RT-qPCR studies involving YLR294C?

    When conducting RT-qPCR studies to measure YLR294C expression or to analyze gene expression in YLR294C mutants, proper reference gene selection is critical for accurate normalization. Unlike studies with static conditions, dynamic transcriptional response studies require specialized reference gene sets.

    Based on validated approaches for yeast gene expression studies, researchers should:

    1. Avoid using single reference genes, which often show condition-dependent variation

    2. Utilize a validated set of reference genes specifically tested for stability under relevant experimental conditions

    3. For studies examining dynamic responses (e.g., shifts in carbon source or nitrogen limitation), use reference genes validated for temporal stability

    A comprehensive study on reference gene selection in dynamic yeast gene expression demonstrated that traditional housekeeping genes often perform poorly as references in studies involving metabolic shifts. Instead, researchers should select from validated gene sets determined through systematic stability analysis .

    As no specific reference gene validation has been published for YLR294C studies, researchers should perform their own validation using approaches like geNorm or NormFinder to identify the most stable reference genes for their specific experimental conditions.

  • What are the emerging technologies that could advance research on uncharacterized proteins like YLR294C?

    Several cutting-edge technologies show promise for elucidating the function of uncharacterized proteins like YLR294C:

    1. CRISPR-Cas9 genome editing: Enables precise genetic modifications beyond simple gene deletions, allowing for domain-specific mutations, promoter modifications, and conditional alleles. This approach could generate more nuanced phenotypes than traditional gene knockouts .

    2. Synthetic genetic array (SGA) analysis: Systematic creation of double mutants to identify genetic interactions. Recent advances in SGA methodology, including Selective Ploidy Ablation (SPA), facilitate high-throughput plasmid transfer into yeast deletion libraries, enabling rapid functional characterization .

    3. Proximity-dependent labeling: BioID or APEX2 tagging of YLR294C could identify proximal proteins in its native cellular environment, revealing potential interaction partners and functional contexts without requiring stable physical interactions.

    4. Single-cell proteomics and transcriptomics: These approaches could reveal cell-to-cell variability in YLR294C expression and identify correlated gene expression patterns at unprecedented resolution.

    5. Cryo-electron microscopy: For structural determination of membrane-associated proteins like YLR294C, which may be challenging to crystallize.

    6. Metabolomics integration: Comprehensive metabolite profiling in YLR294C mutants could reveal specific metabolic pathways affected by the protein's absence, particularly relevant given its potential role in respiration.

    Combining these emerging technologies with traditional approaches could accelerate functional characterization of YLR294C and similar uncharacterized proteins in the yeast genome.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.