Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR374C (YLR374C)

Shipped with Ice Packs
In Stock

Description

General Information

Saccharomyces cerevisiae, commonly known as Baker's yeast, is a well-studied eukaryotic organism used in basic research . Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR374C (YLR374C) is a protein derived from this yeast strain . YLR374C is a putative uncharacterized protein, meaning its function has not yet been fully elucidated through experimentation .

Basic characteristics

CharacteristicDescription
SourceSaccharomyces cerevisiae (strain ATCC 204508 / S288c)
Uniprot No.O13545
Gene NameYLR374C
Protein NamesPutative uncharacterized protein YLR374C
Sequence LengthFull length protein with 129 amino acids
Expression Region1-129
Tag InfoN-terminal 10xHis-tagged
Product TypeRecombinant Protein, Transmembrane Protein
AA SequenceMFILGSVGCVEADEASPLYCLSAALIRLSNDEMGGNVMWFIALLFALLIARCTCHTKNTHPDFSKPTFCHQHAALTNSLSSLYRCFVPDGTAMLPTATKKTPQRRKNGAIIHRVVIYHGR ESANGISKQ

Protein Complex

Saccharomyces cerevisiae contains two comprehensive catalogs of yeast protein complexes, CYC2008 and YHTP2008 . The CYC2008 is a comprehensive catalog of 408 manually curated heteromeric protein complexes reliably backed by small-scale experiments reported in the current literature . The second catalog, YHTP2008, comprises 400 high-throughput complexes annotated with current literature evidence; 262 correspond, at least partially, to CYC2008 complexes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
YLR374C; Putative uncharacterized protein YLR374C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YLR374C
Target Protein Sequence
MFILGSVGCVEADEASPLYCLSAALIRLSNDEMGGNVMWFIALLFALLIARCTCHTKNTH PDFSKPTFCHQHAALTNSLSSLYRCFVPDGTAMLPTATKKTPQRRKNGAIIHRVVIYHGR ESANGISKQ
Uniprot No.

Target Background

Database Links

STRING: 4932.YLR374C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is currently known about the YLR374C protein in Saccharomyces cerevisiae?

YLR374C is a putative uncharacterized protein in Saccharomyces cerevisiae with limited functional characterization. Based on sequence analysis, it is predicted to be involved in cellular processes, but its precise biological function remains to be determined. While specific information about YLR374C is limited in the provided research, we can draw parallels with other yeast proteins like Rev7 that were initially uncharacterized but later found to have important roles in DNA repair pathways. Current approaches to understanding YLR374C would likely include sequence homology analysis, phenotypic studies of deletion mutants, and protein interaction mapping to establish its functional context in yeast cellular processes.

What experimental techniques are recommended for initial characterization of YLR374C?

For initial characterization of YLR374C, researchers should implement a multi-faceted experimental approach:

  • Yeast Two-Hybrid (Y2H) Screening:

    • Clone YLR374C into bait vectors containing GAL4 DNA-binding domain

    • Co-transform with prey vectors containing potential interacting proteins

    • Select positive colonies on appropriate dropout media with 3-aminotriazole

    • Validate with proper controls (empty vectors and known interactors)

  • Subcellular Localization:

    • Create GFP or other fluorescent protein fusions

    • Observe localization patterns under various growth conditions

    • Co-localize with known cellular compartment markers

  • Phenotypic Analysis:

    • Generate YLR374C deletion strains

    • Assess growth under various stress conditions

    • Compare phenotypes with related gene deletions

  • Expression Profiling:

    • Monitor expression under different growth conditions

    • Analyze protein levels throughout cell cycle

    • Determine if expression changes in response to cellular stresses

The Y2H approach has proven particularly valuable for studying uncharacterized proteins, as demonstrated with Rev7, where this technique revealed interactions with the MRX complex components (Mre11, Rad50, and Xrs2) .

How should researchers design experiments to identify potential interaction partners of YLR374C?

To identify potential interaction partners of YLR374C, researchers should implement a comprehensive strategy combining multiple complementary approaches:

  • Yeast Two-Hybrid (Y2H) Analysis:

    • Use YLR374C as both bait (fused to GAL4 DNA-binding domain) and prey (fused to GAL4 activation domain)

    • Screen against genomic or cDNA libraries

    • Validate interactions in different strain backgrounds to rule out strain-specific artifacts

    • Consider testing interactions in deletion backgrounds (e.g., in a YLR374C-deleted strain) to identify interactions independent of endogenous protein

  • Affinity Purification Coupled with Mass Spectrometry:

    • Express epitope-tagged YLR374C in yeast

    • Perform co-immunoprecipitation under various buffer conditions

    • Identify co-purifying proteins by mass spectrometry

    • Validate key interactions by reciprocal co-immunoprecipitation

  • Microscale Thermophoresis (MST):

    • Purify recombinant YLR374C

    • Measure binding affinities to candidate interacting proteins

    • Determine dissociation constants (Kd) for quantitative assessment of interactions

    • Compare binding affinities with known interacting protein pairs as controls

  • In vivo Validation:

    • Perform co-localization studies with fluorescently tagged proteins

    • Use bimolecular fluorescence complementation (BiFC)

    • Assess functional consequences of disrupting specific interactions

Interaction Detection MethodAdvantagesLimitationsData Analysis Approach
Yeast Two-HybridDetects direct binary interactions, high throughputProne to false positives, requires nuclear localizationMultiple colony selection, stringent controls, validation in different strains
Affinity Purification-MSIdentifies protein complexes, preserves native conditionsMay miss transient interactions, includes indirect partnersComparison with control purifications, abundance-based filtering
Microscale ThermophoresisQuantitative binding affinities, requires small sample amountsRequires protein purification, may not reflect in vivo conditionsDetermine Kd values, assess binding cooperativity through Hill coefficients

This multi-method approach increases confidence in identified interactions, as demonstrated with Rev7, where Y2H screening identified interactions with MRX complex components that were subsequently validated through MST with purified proteins .

What strategies can be employed to map functional domains within YLR374C?

To map functional domains within YLR374C, researchers should implement a systematic domain analysis approach:

  • Truncation Analysis:

    • Generate a series of N-terminal and C-terminal truncated variants

    • Test each variant for retention of known functions or interactions

    • Identify minimal regions sufficient for specific activities

    • Ensure comparable expression levels through western blot analysis

  • Site-Directed Mutagenesis:

    • Identify conserved residues through sequence alignment

    • Create point mutations targeting these residues

    • Assess functional consequences of each mutation

    • Group mutations based on phenotypic effects to define functional clusters

  • Domain Swapping:

    • Replace predicted domains with corresponding regions from related proteins

    • Test chimeric proteins for function to confirm domain assignments

    • Evaluate whether specific domains are interchangeable between proteins

The truncation analysis approach proved highly effective in studying Rev7, where a series of N-terminal (Rev7-N1, Rev7-N2, Rev7-N3) and C-terminal (Rev7-C1, Rev7-C2, Rev7-C3) truncated variants revealed that a 42-amino acid C-terminal fragment was both necessary and sufficient for interaction with the MRX complex, while the N-terminal HORMA domain was dispensable for this specific function .

How should researchers design control experiments when studying YLR374C?

  • Genetic Controls:

    • Use isogenic strains differing only in YLR374C status

    • Include both YLR374C deletion and overexpression controls

    • Generate tagged versions of YLR374C to verify functionality post-modification

    • Include YLR374C point mutants to distinguish specific functions

  • Experimental Validation Controls:

    • Complementation tests with wild-type YLR374C to verify phenotype restoration

    • Test findings in different strain backgrounds to rule out strain-specific effects

    • Verify expression levels of all constructs through western blot analysis

    • Include positive controls with known phenotypes or interactions

  • Technical Controls:

    • For Y2H experiments, include:

      • Empty vector controls to detect auto-activation

      • Known interacting protein pairs as positive controls

      • Unrelated proteins as negative controls

    • For biochemical assays:

      • Include enzyme-dead controls

      • Test reaction components individually

      • Perform no-enzyme and no-substrate controls

  • Statistical Controls:

    • Perform at least three independent biological replicates

    • Include technical replicates within each biological replicate

    • Apply appropriate statistical tests based on data distribution

    • Determine adequate sample sizes through power analysis

What are the best approaches for studying potential roles of YLR374C in DNA repair mechanisms?

To investigate potential roles of YLR374C in DNA repair mechanisms, researchers should implement the following methodological framework:

  • DNA Damage Sensitivity Assays:

    • Generate YLR374C deletion and overexpression strains

    • Expose strains to various DNA-damaging agents (UV, MMS, HU, IR)

    • Quantify survival rates and recovery kinetics

    • Compare phenotypes with known DNA repair mutants (including rev7Δ strains)

  • Repair Pathway Analysis:

    • Create double mutants with known components of different repair pathways

    • Assess epistatic relationships to determine pathway association

    • Test for direct interactions with core repair machinery components

    • Examine effects on specific repair outcomes (NHEJ vs HR efficiency)

  • Protein Recruitment Studies:

    • Use ChIP assays to measure recruitment to DNA damage sites

    • Perform live-cell imaging with fluorescently tagged YLR374C

    • Analyze kinetics of recruitment and dissociation from damage sites

  • Biochemical Activity Assessment:

    • Purify recombinant YLR374C protein

    • Test for DNA binding, nuclease, or other enzymatic activities

    • Examine effects on activities of known repair proteins

    • Assess potential regulatory roles on other repair factors

DNA Damaging AgentExperimental ApproachReadoutComparative Controls
Hydroxyurea (HU)Spot assays, liquid culture growthSurvival rate, doubling timeG-quadruplex DNA synergized HU sensitivity
UV radiationColony formation after UV exposureSurvival curveKnown NER pathway mutants
Methyl methanesulfonate (MMS)Growth in MMS-containing mediaGrowth inhibitionBER pathway mutants
Ionizing radiationColony formation after gamma irradiationSurvival curveNHEJ and HR pathway mutants

How can researchers develop quantitative assays to measure potential enzymatic activities of YLR374C?

To develop quantitative assays for potential enzymatic activities of YLR374C, researchers should implement a systematic approach:

  • Activity Hypothesis Generation:

    • Analyze sequence for motifs suggesting specific enzymatic functions

    • Consider activities of proteins with similar domains or interaction partners

    • Examine phenotypic consequences of deletion for activity clues

    • Review activities of interacting proteins for potential regulatory roles

  • Biochemical Assay Development:

    • Express and purify recombinant YLR374C

    • Test for nuclease activity if DNA repair involvement is suspected

    • Assess ATPase/GTPase activity if energy-dependent functions are predicted

    • Measure potential effects on interacting proteins' activities

  • Enzyme Kinetics Analysis:

    • Determine optimal reaction conditions (pH, salt, cofactors)

    • Measure activity across substrate concentration range

    • Calculate kinetic parameters (Km, Vmax, kcat)

    • Assess effects of potential inhibitors or activators

  • Regulatory Activity Assessment:

    • Test YLR374C's effect on activities of interacting proteins

    • Compare wild-type with catalytically inactive mutants

    • Measure concentration-dependent effects on partner proteins

    • Analyze cooperative or competitive effects on multiprotein complexes

Drawing from the Rev7 study methodology, researchers could investigate whether YLR374C affects the activities of its interaction partners, similar to how Rev7 was found to impede Mre11 nuclease and Rad50's ATPase activities without affecting ATP-binding ability .

How should researchers interpret contradictory data when studying YLR374C function?

When faced with contradictory data regarding YLR374C function, researchers should implement a systematic resolution approach:

  • Experimental Condition Analysis:

    • Evaluate differences in strain backgrounds

    • Compare growth conditions and media compositions

    • Assess protein expression levels across experiments

    • Consider cell cycle phase and metabolic state differences

  • Methodological Cross-validation:

    • Validate findings using multiple independent techniques

    • Ensure proper controls are included in all experiments

    • Verify reagent specificity and experimental conditions

    • Test whether contradictions persist across different methodologies

  • Context-dependent Function Assessment:

    • Test YLR374C function under various stress conditions

    • Examine potential cell cycle-dependent functions

    • Consider protein interaction partners present in different conditions

    • Assess post-translational modifications affecting function

  • Integration Framework for Resolving Contradictions:

Contradiction TypeSystematic Investigation ApproachPotential Resolution StrategiesDocumentation Requirements
Phenotypic DiscrepanciesTest multiple strain backgrounds, vary growth conditionsIdentify strain-specific genetic modifiersComplete strain genotypes, growth condition details
Interaction InconsistenciesCompare Y2H, co-IP, and in vitro bindingIdentify condition-dependent interactionsBuffer compositions, tag positions, expression levels
Functional ConflictsTest function in different cellular contextsIdentify context-dependent rolesComprehensive experimental conditions
Localization DifferencesCompare fixation methods, tag positionsResolve technical artifacts vs. biological variationImaging parameters, fusion protein verification

As demonstrated in the Rev7 study, systematic investigation of protein function across different genetic backgrounds (wild-type, rev3Δ, and mre11Δ rad50Δ xrs2Δ strains) can help resolve apparent contradictions by revealing context-dependent mechanisms .

How can findings about YLR374C inform our understanding of DNA repair pathways in eukaryotes?

Integrating YLR374C findings into the broader context of DNA repair pathways requires systematic comparative analysis:

  • Evolutionary Context Analysis:

    • Compare YLR374C with functionally related proteins across species

    • Identify conserved domains and interaction motifs

    • Assess whether YLR374C represents an alternative mechanism for functions performed by other proteins in different species

    • Consider whether YLR374C represents a specialized adaptation in yeast

  • Pathway Integration Assessment:

    • Determine where YLR374C functions within established repair pathways

    • Identify whether it acts as a regulator, scaffold, or enzymatic component

    • Assess interactions with core repair machinery components

    • Map genetic interactions with known pathway members

  • Mechanism Comparison:

    • Compare YLR374C's mechanism with analogous proteins in other organisms

    • Assess whether it represents a yeast-specific mechanism or a conserved function

    • Determine if YLR374C functions similarly to more characterized proteins like Rev7

    • Identify unique aspects of YLR374C function compared to known repair factors

  • Translational Relevance:

    • Consider implications for understanding repair pathways in higher eukaryotes

    • Assess potential relevance to human disease mechanisms

    • Identify whether YLR374C function parallels processes dysregulated in cancer

    • Evaluate potential as a model for studying repair pathway choice mechanisms

The Rev7 study provides an excellent model for this integration, showing how a relatively uncharacterized yeast protein can reveal alternative mechanisms for DNA repair pathway choice that may be conserved across species lacking specific components (like the Shieldin complex) found in human cells .

What are the best practices for publishing and sharing YLR374C research findings?

To maximize the impact and reproducibility of YLR374C research, researchers should follow these best practices:

  • Comprehensive Methodology Documentation:

    • Provide detailed experimental procedures with all parameters

    • Include complete strain tables with genotypes and construction methods

    • Document all plasmids with complete sequences and verification methods

    • Specify statistical analysis methods and sample sizes

  • Experimental Design Transparency:

    • Clearly state the research problem being addressed

    • Define all variables (independent, dependent, controlled) with units

    • Document multiple trials/replicates for each experiment

    • Include detailed procedures and setup diagrams

  • Resource Sharing:

    • Deposit strains in public repositories (e.g., Yeast Genetic Resource Center)

    • Share plasmids through Addgene or similar platforms

    • Provide detailed protocols on protocols.io

    • Make custom analysis code available through GitHub

  • Data Presentation Standards:

    • Present data in clear, appropriately labeled figures

    • Include raw data in supplementary materials

    • Use proper statistical analyses with error representation

    • Present both positive and negative results

  • Publication Recommendations:

Research Output TypeRecommended DocumentationRepository OptionsCommunity Standards
Genetic ConstructsComplete sequences, markers, cloning strategyAddgene, YGRCFull annotation, verification evidence
Phenotypic DataRaw measurements, statistical analysis methodsSupplementary materials, FigShareMultiple trials, appropriate controls
Interaction DataFull interactome, validation methodologyBioGRID, IntActMultiple detection methods, control interactions
MicroscopyUnprocessed images, processing parametersBioImage ArchiveLabeled scale bars, consistent settings
Biochemical AssaysReagent sources, purification methods, enzyme kineticsProtein Data Bank (for structures)Activity units, concentration details

Following the established standards for experimental design and reporting, as outlined in the Science Olympiad guidelines, ensures that research on YLR374C will be reproducible and valuable to the broader scientific community .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.