Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR444C (YLR444C)

Shipped with Ice Packs
In Stock

Description

Overview and Genetic Context

YLR444C is a 100-amino acid protein encoded by the YLR444C gene in S. cerevisiae. The gene is classified as a dubious open reading frame (ORF) due to insufficient experimental evidence supporting its functionality . It is part of the reference genome of the laboratory strain S288C . While its biological role remains unclear, recombinant forms have been produced for research purposes .

Sequence and Domains

  • Length: 100 amino acids .

  • Molecular Weight: Predicted ~11 kDa (exact value not experimentally verified) .

  • Isoelectric Point: Computational estimates suggest a pI of ~5.0–6.0 .

  • Tags: Recombinant versions are fused with an N-terminal His tag for purification .

Interactions and Predicted Partners

Data from the STRING database highlight potential interactions :

Interacting ProteinDescriptionInteraction Score
ECM7Integral membrane protein involved in calcium uptake and cell wall integrity0.800
YDL228CDubious ORF overlapping verified gene SSB10.406
YNL043CDubious ORF overlapping verified gene YIP30.406

These interactions suggest a possible ancillary role in calcium homeostasis or cell wall maintenance, though experimental validation is lacking .

Recombinant Production and Availability

Recombinant YLR444C is commercially available for research, produced in E. coli expression systems :

Product CodeHostTagLengthSource
RFL30157SFE. coliHisFull (1–100 aa)[Creative BioMart]

Key Specifications :

  • Purity: >85% (SDS-PAGE).

  • Storage: Lyophilized, stable at -80°C.

Hypothetical Roles

  • Calcium Signaling: Indirect association with ECM7 implies a potential role in calcium uptake pathways .

  • Cell Wall Dynamics: Mutants of related proteins (e.g., ECM7) display cell wall defects, suggesting YLR444C might contribute to structural integrity .

Challenges

  • Dubious Classification: Annotations from SGD and STRING emphasize that YLR444C is unlikely to encode a functional protein .

  • No Validated Pathways: Public databases list no confirmed pathways or enzymatic activities for YLR444C .

Comparative Genomics

  • Evolutionary Context: S. cerevisiae strains are categorized into "wild" (e.g., tree exudates) and "domesticated" (e.g., wine-making) populations . YLR444C is conserved in laboratory and industrial strains but absent in wild isolates, hinting at niche-specific pseudogenization .

Future Directions

  • Functional Studies: Knockout models or CRISPR-based screens could clarify if YLR444C impacts yeast physiology under stress conditions.

  • Structural Biology: X-ray crystallography or cryo-EM might resolve its tertiary structure and ligand-binding potential.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
YLR444C; Putative uncharacterized protein YLR444C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YLR444C
Target Protein Sequence
MMGERIQNCNADEGLITLCILSSLSLLDRNLMSCNSNSSLVANGSCLPPLLIFAVGFPWS KLVLASFSLFKSTSDVFLIVAIVSLFLISSASPEVDCRCG
Uniprot No.

Target Background

Database Links

STRING: 4932.YLR444C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What experimental systems are most appropriate for studying YLR444C function?

The choice of experimental system depends on your specific research questions. Based on established protocols for recombinant S. cerevisiae proteins, laboratory strains like W303-1A offer good genetic tractability and are well-characterized for protein expression studies . Industrial strains such as TH-AADY derivatives may be preferred when investigating protein function under fermentation conditions . When designing your experimental system, consider:

  • Using haploid strains for cleaner genetic backgrounds

  • Implementing marker-based selection systems (such as URA3 selection markers)

  • Comparing results across multiple strain backgrounds to ensure robustness

Notably, strain-specific differences in protein quality control mechanisms like the unfolded protein response (UPR) can significantly impact recombinant protein expression and function . When expressing YLR444C in different strain backgrounds, systematically measure growth rates and protein expression levels to account for strain variability.

How should researchers approach characterizing a putative uncharacterized protein like YLR444C?

Characterization of uncharacterized proteins requires a multifaceted approach:

  • Sequence analysis: Perform thorough bioinformatic analyses comparing YLR444C with characterized proteins across species to identify potential functional domains.

  • Expression profiling: Quantify mRNA and protein levels under various growth conditions and stressors to identify conditions that modulate expression levels.

  • Subcellular localization: Use fluorescent tagging (GFP fusions) to determine where YLR444C localizes within the cell.

  • Phenotypic screening: Create deletion and overexpression strains to observe phenotypic consequences under different growth conditions.

  • Interaction partners: Implement techniques like affinity purification followed by mass spectrometry to identify potential protein-protein interactions.

For optimal results, combine multiple complementary approaches rather than relying on a single method. This strategy compensates for the limitations inherent in each individual technique.

What are the optimal expression strategies for studying YLR444C in recombinant systems?

When designing expression systems for YLR444C, consider these evidence-based approaches:

Plasmid Selection:

  • Episomal plasmids like YEplac195 provide high copy numbers and strong expression but may impose metabolic burden

  • Integration-based approaches using CRISPR-Cas9 offer more stable expression with less copy number variation

Promoter Considerations:

  • Constitutive promoters provide consistent expression for phenotypic studies

  • Inducible promoters allow for controlled expression timing to study immediate effects of the protein

Protein Tagging Strategies:
Based on established recombinant protein studies in yeast, consider both N- and C-terminal tags since the optimal position depends on protein structure:

  • For secreted proteins: Signal peptides like those used for β-glucosidase expression

  • For surface display: Cell wall protein (CWP) anchoring domains similar to the cwp2 system

Expression StrategyAdvantagesLimitationsBest Applications
Episomal plasmidsHigh expression levels, easy to constructPlasmid instability, high cell-to-cell variationInitial characterization studies
Genomic integrationStable expression, reduced cell-to-cell variationLower expression levels, more complex constructionLong-term studies, stress response analyses
Cell surface displayEasier functional assessmentMay interfere with protein functionProtein-protein interaction studies
SecretionSimplifies purificationNot suitable for all proteinsBiochemical characterization

Monitor UPR activation during expression, as high expression levels of recombinant proteins can trigger cellular stress responses that influence experimental outcomes .

How can researchers effectively implement quasi-experimental designs when studying YLR444C function?

When randomized controlled trials are impractical or unethical in YLR444C research, quasi-experimental designs offer a valuable alternative. Based on established methodological principles :

  • Nonequivalent groups design: Compare YLR444C function in different yeast strain backgrounds while controlling for confounding genetic factors.

  • Regression discontinuity: Utilize natural thresholds in YLR444C expression levels to study functional effects.

  • Natural experiments: Leverage environmental perturbations that naturally affect YLR444C expression.

When implementing quasi-experimental designs, carefully address threats to internal validity:

  • Selection bias: Match treatment and control groups on relevant characteristics

  • History effects: Account for external events that might influence your dependent variables

  • Maturation: Control for time-dependent changes in your experimental system

  • Testing effects: Consider how repeated measurements might influence your results

To enhance quasi-experimental validity when studying YLR444C:

  • Collect pre-treatment measurements where possible

  • Use multiple control groups to account for different confounding variables

  • Implement statistical controls for known confounding variables

  • Consider propensity score matching to create comparable experimental groups

How does the unfolded protein response (UPR) impact studies of recombinant proteins like YLR444C?

The UPR is a critical cellular quality control mechanism that can significantly impact recombinant protein studies in yeast. Understanding this relationship is essential when designing experiments involving YLR444C:

  • UPR activation assessment: Monitor UPR activation during YLR444C expression using reporter systems like UPRE-lacZ, which can be quantified through β-galactosidase activity assays .

  • Strain-specific considerations: Different yeast strains show distinct UPR responses. For example, research indicates laboratory strains like W303-1A derivatives show slower and more prolonged UPR activation compared to industrial strains, which exhibit rapid but transient activation .

  • Impact on data interpretation: UPR activation can affect:

    • Protein folding and stability

    • Cell growth rates (demonstrated by varying OD600 values in UPR-activated strains)

    • Experimental reproducibility

When high levels of YLR444C expression trigger UPR, consider these methodological approaches:

  • Monitor HAC1 mRNA splicing as a direct indicator of UPR activation

  • Quantify expression of UPR target genes to assess the magnitude of the response

  • Design experiments with appropriate time points, as UPR activation kinetics vary significantly between strains (peaking at ~2 hours in some strains versus 16 hours in others)

What approaches can researchers use to identify potential functions of YLR444C?

Identifying functions of uncharacterized proteins requires multiple complementary approaches:

Comprehensive Phenotypic Profiling:

  • Expose YLR444C deletion and overexpression strains to diverse stressors (temperature, pH, oxidative agents, ethanol, acetic acid)

  • Quantify growth parameters under each condition

  • Assess cellular responses using reporter systems for key pathways

Integration with Systems Biology Data:

  • Correlate YLR444C expression patterns with known functional networks

  • Use genome-wide screens to identify genetic interactions

  • Apply metabolomic profiling to identify changes in cellular metabolism

Computational Prediction Enhanced by Experimental Validation:
When computational predictions suggest potential functions, design targeted experiments to validate these hypotheses. For example, if sequence analysis suggests involvement in protein quality control:

  • Measure β-galactosidase activity under conditions known to induce protein misfolding

  • Compare HAC1 mRNA splicing patterns between wildtype and YLR444C mutant strains

  • Assess expression of UPR target genes through RT-qPCR

How should researchers address growth and expression variability in YLR444C studies?

Growth and expression variability can significantly impact experimental reproducibility. Based on established protocols for recombinant yeast studies:

  • Standardize culture conditions: Pre-cultivate strains twice in appropriate media (e.g., YPD) for 16-20 hours at 30°C before experiments to ensure consistent physiological states .

  • Implement precise inoculation protocols: Start experimental cultures at defined optical densities (e.g., OD600 = 0.2) and grow to mid-log phase (e.g., OD600 = 2.0 ± 0.1) before treatments .

  • Control environmental factors: Conduct experiments in temperature-controlled environments with consistent agitation (e.g., 30°C, 220 rpm for growth, 150 rpm during treatments) .

  • Ensure consistent sampling: Aliquot cultures in identical volumes (e.g., 50 ml in 250 ml flasks) and seal consistently to maintain comparable gas exchange rates .

  • Normalize expression data appropriately: Use total protein content measurements (e.g., Bradford assay) rather than just cell density when normalizing expression data .

When comparing YLR444C expression across different strains, systematically document growth parameters and protein expression levels in parallel with functional assays to identify potential correlations between growth variation and functional outcomes.

What strategies can address the challenges of studying poorly expressed or unstable recombinant proteins in yeast?

When investigating a challenging protein like YLR444C, researchers may encounter expression or stability issues. Based on successful approaches for other recombinant yeast proteins:

  • Codon optimization: Adapt the coding sequence to match the preferred codon usage of S. cerevisiae to enhance translation efficiency.

  • Fusion partners: Employ stability-enhancing fusion partners while ensuring they can be removed if necessary for functional studies.

  • Expression timing: Use inducible promoters with carefully optimized induction protocols to balance expression levels with cellular capacity.

  • UPR modulation: As UPR activation impacts recombinant protein expression, consider co-expression of folding chaperones or modulation of UPR components to enhance protein stability .

  • Culture optimization: Optimize media composition and growth conditions (temperature, pH) based on systematic experimentation.

For extremely challenging proteins, consider implementing specialized approaches:

  • Heat-killed whole recombinant yeast systems that preserve protein antigenic properties while eliminating viability concerns

  • Cell-surface display strategies that can stabilize proteins in the cell wall environment

How should contradictory results in YLR444C functional studies be reconciled?

Contradictory results are common when studying uncharacterized proteins. A systematic approach to reconciliation includes:

  • Strain-specific effects: Compare results across multiple strain backgrounds, as research demonstrates significant strain-dependent differences in protein expression outcomes and cellular responses .

  • Methodological differences: Analyze how differences in experimental conditions (media composition, growth phase, temperature) might explain contradictory findings.

  • UPR involvement: Examine whether differences in UPR activation could explain conflicting results. The timing and magnitude of UPR activation varies significantly between strains and conditions .

  • Statistical robustness: Re-evaluate statistical approaches, ensuring appropriate statistical tests, sufficient replication, and proper controls were implemented across studies.

When reconciling contradictory data, implement a meta-analytical approach:

  • Systematically catalog all experimental variables across studies

  • Identify patterns of results associated with specific methodological choices

  • Design critical experiments specifically targeting the variables most likely to explain discrepancies

What analytical frameworks best support studying interactions between YLR444C and cellular stress responses?

When investigating interactions between YLR444C and stress responses like the UPR, implement these analytical approaches:

  • Time-course analysis: Cellular responses to stress are highly dynamic. Design experiments with appropriate time points (from 2 hours to 48 hours) to capture both immediate and adaptive responses .

  • Multi-level measurements: Simultaneously measure:

    • Gene expression changes (e.g., HAC1 mRNA splicing, UPR target genes)

    • Protein-level changes (e.g., β-galactosidase activity)

    • Physiological responses (e.g., growth rate, metabolite production)

  • Pathway-specific reporters: Implement reporter systems for specific cellular pathways potentially affected by YLR444C function .

  • Integrative data analysis: Apply multivariate statistical methods to identify relationships between YLR444C expression/function and cellular response variables.

When designing these studies, consider the documented interactions between different cellular stressors. For example, ethanol and acetic acid can both induce UPR during fermentation processes, potentially affecting YLR444C function in complex ways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.