Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YML009W-B (YML009W-B)

Shipped with Ice Packs
In Stock

Description

Production and Expression

YML009W-B is synthesized via recombinant DNA technology:

  • Expression System: Expressed in E. coli under optimized conditions for high-yield production.

  • Purification: Affinity chromatography (His-tag) followed by lyophilization for storage .

  • Yield and Quality: The protein is delivered as a lyophilized powder with guaranteed purity >90% .

Key Considerations

  • Storage: Stable at -20°C/-80°C; repeated freeze-thaw cycles are discouraged .

  • Reconstitution: Glycerol (5–50% final concentration) is recommended for long-term stability .

Research Findings and Functional Insights

Despite its uncharacterized status, YML009W-B has been utilized in structural and biochemical studies. Notable observations include:

Expression and Localization

  • No Known Expression Data: The Saccharomyces Genome Database (SGD) reports no experimental expression data for YML009W-B under tested conditions .

  • Hypothesized Role: As a putative uncharacterized protein, its function remains undefined. Potential roles may include participation in cellular processes such as protein folding, stress response, or membrane organization, though no direct evidence exists .

Applications in Research

  • Antigen for ELISA: Available as an ELISA kit for detecting specific antibodies, indicating its utility in immunological studies .

  • Control in Recombinant Studies: Serves as a negative control or reference protein in experiments involving yeast-derived recombinant proteins .

Comparative Analysis with Related Proteins

YML009W-B shares structural similarities with other uncharacterized yeast proteins, though functional homology is unconfirmed. Below is a comparison with related proteins:

ParameterYML009W-BOther Yeast Proteins (e.g., CWP2, YGP1)
Length158 aaVaries (e.g., 200–300 aa)
TaggingHis-tagNative or tagged (e.g., FLAG)
Expression SystemE. coliNative (S. cerevisiae) or engineered strains
FunctionUncharacterizedCell wall organization, stress response

Future Directions and Challenges

  • Functional Characterization: High-throughput screening or knockout studies in S. cerevisiae are needed to elucidate YML009W-B’s role.

  • Structural Studies: X-ray crystallography or NMR could reveal interactions with other proteins or ligands.

  • Industrial Applications: Potential uses in bioprocessing (e.g., improving protein secretion) require further exploration .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
YML009W-B; YML010W-A; Putative uncharacterized protein YML009W-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YML009W-B
Target Protein Sequence
MRMEAQVVAVSPHGVVLPLGVAKVMEVHPLGAVLAAVPQLGAAKVLVLLLLGVVLQPGVT NQVGAVHPLGRRVVNLMVPCLLGVVPVIGQPTAGLPPGEEITIIKVQEMAELLHGVTKTM EIGLLGTTKEISQTMVVTVHGEVINHQKENQYHPRRNQ
Uniprot No.

Target Background

Database Links

STRING: 4932.YML009W-B

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YML009W-B and how is it classified in the Saccharomyces cerevisiae genome?

YML009W-B is classified as a putative uncharacterized protein in Saccharomyces cerevisiae (baker's yeast). It is designated as a "dubious open reading frame" (ORF) in the yeast genome according to the Saccharomyces Genome Database . The gene is located on chromosome 13 and notably overlaps with the 3' end of SPT5, an essential gene involved in transcription elongation processes . This overlap has significant implications for functional studies, as deletions affecting YML009W-B can potentially impact SPT5 function by truncating its C-terminal region.

How has YML009W-B been studied in genome-wide screens?

YML009W-B has been identified in multiple genome-wide screens, particularly those focused on:

  • Ty1 mobility restriction - YML009W-B was identified among 91 mutants affecting Ty1 transposon mobility

  • DNA damage response - Deletion mutants affecting YML009W-B showed increased sensitivity to gamma radiation

  • BRCA1 lethality suppression - YML009W-B truncation suppresses BRCA1-induced lethality in yeast

  • Metabolic profiling - Deletion mutants have been analyzed for changes in amino acid profiles

These screens have provided indirect evidence of YML009W-B's potential involvement in transcription, DNA repair mechanisms, and cellular metabolism, despite its classification as a dubious ORF.

What is the relationship between YML009W-B and SPT5?

YML009W-B overlaps with the 3' end of SPT5, an essential gene encoding a component of the DSIF (5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole sensitivity inducing factor) complex that regulates RNA polymerase II transcription elongation . When the YML009W-B region is deleted:

  • It effectively truncates the C-terminal domain of Spt5p

  • The resulting truncated Spt5p retains viability but exhibits altered functionality

  • Cells show increased sensitivity to DNA damaging agents

  • BRCA1-induced lethality is suppressed

This genetic arrangement creates a unique opportunity for researchers to study partial loss-of-function of SPT5 through YML009W-B deletions, as complete SPT5 deletion is lethal . The ability to maintain viable cells with truncated Spt5p makes this system valuable for studying transcription elongation factors.

How does deletion of YML009W-B affect DNA repair mechanisms?

Deletion or truncation of YML009W-B significantly impacts DNA repair efficiency, evident from increased sensitivity to DNA damaging agents:

  • Gamma radiation sensitivity: YML009W-B (and by extension, truncated SPT5) mutants show greater sensitivity to gamma radiation compared to wild-type strains, indicating impaired double-strand break repair .

  • Response to S-phase-specific damage: Strains with deletions affecting YML009W-B exhibit increased sensitivity to hydroxyurea (HU) and methyl methanesulfonate (MMS), suggesting a role in DNA replication-associated repair .

  • Genetic interactions with repair pathways: Evidence suggests that the protein functions in a pathway that intersects with BRCA1-mediated repair processes, as YML009W-B truncation suppresses BRCA1 lethality in yeast models .

These phenotypes are consistent with the role of transcription elongation factors in transcription-coupled repair and the maintenance of genome stability.

What metabolic changes are observed in YML009W-B deletion mutants?

Metabolic profiling of YML009W-B deletion strains reveals significant alterations in amino acid homeostasis. According to metabolic gene card data:

  • YML009W-B deletion affects the free amino acid profile under exponential growth in minimum synthetic medium

  • These changes are quantified using multivariate statistics (χ²-test) and univariate statistics (Z-test)

  • The metabolic signature of YML009W-B deletion can be clustered with other genes of similar function

  • These metabolic changes provide insights into the potential functional role of YML009W-B in cellular metabolism

This metabolic approach offers complementary evidence to genetic and functional studies, providing additional context for understanding YML009W-B's role in cellular processes.

How can researchers effectively create and validate YML009W-B deletion/truncation mutants?

Creating precise YML009W-B deletion mutants requires careful consideration of its overlap with SPT5. Recommended methodology includes:

  • PCR-mediated gene disruption: Use of primers designed to delete only the YML009W-B region without disrupting essential SPT5 functions. The typical approach employs pFA6MX4-based deletion cassettes with kanamycin resistance markers .

  • Verification strategies:

    • PCR verification of correct integration

    • Sequencing to confirm precise deletion boundaries

    • Western blot analysis to verify production of truncated Spt5p

    • Phenotypic confirmation through sensitivity to transcription inhibitors like 6-azauracil

  • Control considerations: Because YML009W-B deletion affects SPT5, researchers should include SPT4 deletion mutants as functional controls, as Spt4p partners with Spt5p in the DSIF complex .

Validation should include confirmation of expected phenotypes such as radiation sensitivity and altered transcription elongation profiles to ensure the mutant behaves as expected.

What experimental approaches can be used to investigate YML009W-B's role in transcription elongation?

To study YML009W-B's (and by extension, truncated Spt5p's) role in transcription elongation:

  • Chromatin immunoprecipitation (ChIP) to assess RNA polymerase II occupancy and distribution across genes in YML009W-B mutants compared to wild-type strains

  • Transcriptional run-on assays to measure the elongation rate of RNA polymerase II in real-time

  • RNA-seq analysis to identify specific genes or transcripts affected by YML009W-B deletion/SPT5 truncation, with particular attention to:

    • Changes in mRNA levels

    • Alternative splicing patterns

    • Premature transcription termination

  • 6-azauracil sensitivity testing - this compound depletes nucleotide pools and specifically affects transcription elongation, making it a useful phenotypic test for elongation defects

  • Genetic interaction mapping with known transcription elongation factors such as TFIIS, PAF complex components, and CTD kinases to position YML009W-B/SPT5 within the transcription elongation network

What is the relationship between YML009W-B/SPT5 truncation and BRCA1 lethality suppression?

The relationship between YML009W-B/SPT5 truncation and BRCA1 lethality suppression represents an advanced research area with therapeutic implications:

This research area may provide insights into how transcription elongation and DNA repair are coordinated, with potential implications for understanding BRCA1-related cancers.

What protocols are recommended for expression and purification of recombinant YML009W-B?

For expression and purification of recombinant YML009W-B:

  • Expression system selection:

    • E. coli BL21(DE3) with T7 promoter-based vectors for high-yield bacterial expression

    • Yeast expression systems (e.g., P. pastoris) for native-like post-translational modifications

    • Insect cell systems for complex eukaryotic expression

  • Purification strategy:

    • Affinity tag selection (His6, GST, or MBP tags) for initial capture

    • Ion exchange chromatography for intermediate purification

    • Size exclusion chromatography for final polishing

    • Storage in Tris-based buffer with 50% glycerol at -20°C for extended stability

  • Quality control metrics:

    • SDS-PAGE to verify purity and molecular weight

    • Western blotting for immunological confirmation

    • Mass spectrometry for sequence verification

    • Functional assays based on predicted activities

How can researchers effectively analyze the impact of YML009W-B on genomic stability?

To analyze YML009W-B's impact on genomic stability:

  • Gamma radiation sensitivity assays:

    • Culture strains to stationary phase

    • Expose to increasing doses of gamma radiation

    • Plate on appropriate media to determine survival fraction

    • Compare YML009W-B mutants with wild-type and known repair-deficient strains

  • Sensitivity to chemical DNA damaging agents:

    • Hydroxyurea (HU) for replication stress

    • Methyl methanesulfonate (MMS) for alkylation damage

    • Bleomycin for oxidative damage and double-strand breaks

    • Serial dilution spot assays at varying concentrations

  • Chromosomal stability assessment:

    • Fluctuation analysis for spontaneous mutation rates

    • Gross chromosomal rearrangement assays

    • Microsatellite instability testing

    • Ty1 mobility assays as YML009W-B has been identified in Ty1 mobility screens

  • Direct DNA repair capacity measurements:

    • Comet assay for direct measurement of DNA breaks

    • Pulse-field gel electrophoresis to visualize chromosome integrity

    • ChIP assays to examine recruitment of repair factors to damage sites

What methodologies are optimal for investigating metabolic changes in YML009W-B deletion strains?

For comprehensive metabolic analysis of YML009W-B deletion strains:

  • Amino acid profiling:

    • Grow strains in minimum synthetic medium to exponential phase

    • Extract free amino acids using established protocols

    • Quantify using HPLC or LC-MS/MS methods

    • Calculate relative levels compared to wild-type strains

    • Apply robust statistical analysis using Minimum Covariance Determinant (MCD)

  • Metabolomic approaches:

    • Untargeted metabolomics to identify broader metabolic changes

    • Stable isotope labeling to track metabolic flux

    • Focus on pathways potentially affected by transcription elongation defects

  • Data analysis frameworks:

    • Multivariate statistics (χ²-test) and univariate statistics (Z-test)

    • Hierarchical clustering to identify genes with similar metabolic signatures

    • Gene ontology (GO) enrichment analysis of metabolically similar strains

    • Comparison with physical and genetic interaction networks

  • Validation experiments:

    • Targeted enzyme assays for affected pathways

    • qPCR of metabolic genes potentially affected

    • Complementation studies to confirm specificity

How does the overlap between YML009W-B and SPT5 complicate functional genomics approaches?

The overlap between YML009W-B and SPT5 creates several methodological challenges and research opportunities:

  • Attribution of function: When phenotypes are observed in YML009W-B deletion strains, researchers must determine whether these result from:

    • Loss of a functional YML009W-B protein

    • Truncation of the C-terminal domain of Spt5p

    • Disruption of regulatory elements affecting SPT5 expression

  • Design considerations for genome editing:

    • CRISPR-Cas9 approaches must be designed to avoid unintended effects on SPT5

    • Point mutations may be preferable to complete deletions

    • Complementation with full-length SPT5 should be included as a control

  • Interpretation of high-throughput data:

    • Bioinformatic analysis of RNA-seq, ChIP-seq, and other omics data needs to account for the genomic overlap

    • Differential effects on sense and antisense transcription should be considered

    • The impact on neighboring genes must be evaluated

Research strategies that can address these complications include careful genetic complementation studies, domain-specific mutations, and comparative analysis with SPT4 deletion mutants, which affect the same complex without the genomic overlap complications.

What is the relationship between YML009W-B/SPT5 truncation and Ty1 mobility restriction?

YML009W-B has been identified in screens for genes affecting Ty1 mobility:

  • Evidence from genetic screens: YML009W-B is among 91 identified mutants that increase Ty1 mobility (Ty1 restriction genes) .

  • Possible mechanisms:

    • Altered chromatin structure affecting Ty1 integration sites

    • Changes in transcription elongation that impact Ty1 expression

    • Disrupted co-transcriptional processes that normally limit Ty1 mobility

  • Research approaches:

    • Quantitative Ty1 mobility assays in YML009W-B mutants

    • Analysis of Ty1 integration site preferences

    • Examination of Ty1 RNA and cDNA levels

    • ChIP analysis of chromatin marks at Ty1 elements and integration sites

  • Broader implications: This relationship may provide insights into how transcription elongation factors contribute to genome stability by regulating transposable elements .

How can the metabolic signature of YML009W-B deletion inform our understanding of its function?

Metabolic profiling provides valuable complementary evidence to genetic and molecular approaches:

  • Functional inference from metabolic signatures:

    • Comparison with deletion strains of known function

    • Identification of 280 distinct metabolic groups through hierarchical clustering

    • Testing for overrepresentation of GO terms, phenotypes, and co-citation in literature

    • Assignment of potential functions to YML009W-B based on its metabolic profile

  • Integration with transcriptional function:

    • Analysis of whether metabolic changes reflect altered expression of metabolic genes

    • Investigation of direct links between transcription elongation defects and metabolic adaptation

    • Examination of whether specific metabolic pathways are particularly sensitive to YML009W-B deletion

  • Experimental approaches:

    • Targeted metabolic enzyme assays based on metabolic profile hints

    • Transcriptional analysis of metabolic genes showing altered regulation

    • Synthetic genetic array analysis to identify genetic interactions with metabolic genes

This integrative approach may reveal unexpected functional connections between transcription elongation factors and cellular metabolism, potentially identifying new regulatory mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.