Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YML099W-A (YML099W-A)

Shipped with Ice Packs
In Stock

Description

Basic Properties and Expression

YML099W-A is derived from the S. cerevisiae genome (strain S288C) and corresponds to the locus YML099W-A. Key characteristics include:

PropertyValueSource
Gene NameYML099W-A
UniProt IDQ6B2I9 ,
Sequence Length109 amino acids (full-length)
Expression HostE. coli ,
TagN-terminal His-tag ,
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0 ,

The protein is lyophilized and stored at -20°C/-80°C, with repeated freeze-thaw cycles discouraged to preserve stability .

Research Applications and Functional Insights

YML099W-A is primarily used in structural and functional studies. Key applications include:

ApplicationDetailsSource
Recombinant Protein StudiesUsed to investigate protein folding, stability, or interactions. ,
ELISA KitsEmployed in immunological assays to detect YML099W-A in biological samples.
Structural HomologyCompared to cupin fold proteins (e.g., YML079w) to hypothesize ligand-binding or enzymatic roles. ,

Despite these applications, no direct evidence links YML099W-A to specific metabolic pathways or cellular processes. Its annotation as “uncharacterized” reflects the lack of experimental validation .

Challenges and Future Directions

YML099W-A remains poorly understood, with critical gaps in functional and structural data. Key challenges include:

  • Lack of Functional Annotation: No GO terms or catalytic activities are assigned to this protein .

  • Structural Uncertainty: While homologous to cupin fold proteins, its precise fold and ligand-binding capacity require experimental validation .

  • Research Priorities: Future studies should focus on:

    1. Enzymatic Assays: Testing for epimerase, ligand-binding, or redox activities.

    2. Interactome Mapping: Identifying protein-protein or protein-ligand interactions.

    3. Genetic Knockouts: Assessing phenotypic effects in S. cerevisiae.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preference for a particular tag type, please inform us, and we will prioritize its development.
Synonyms
YML099W-A; YML100W-A; Putative uncharacterized protein YML099W-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YML099W-A
Target Protein Sequence
MNSENSKITFKPNILIKGVYIFVLYGMCICIVKNYFKTQLFQLLAPAIHEKSKNNIFMIA SDSFPNLYKQNTNYRPAHPLSVASKLPTLLAWLPNRSPLHFQLIWLPIF
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YML099W-A and what are its basic characteristics?

YML099W-A is a putative uncharacterized protein from Saccharomyces cerevisiae (baker's yeast) consisting of 109 amino acids . As a putative protein, its complete functional characterization remains to be fully elucidated. The protein is part of the extensive S. cerevisiae proteome, which has been instrumental in understanding fundamental eukaryotic cellular processes .

The basic structural characteristics include:

FeatureDetails
Protein LengthFull Length (1-109 amino acids)
Expression SystemE. coli
Available TagsHis-tag
SpeciesSaccharomyces cerevisiae
Protein TypePutative uncharacterized protein

Understanding this protein contributes to the completeness of the functional map of cellular processes that researchers are working to construct in yeast genomics.

Why is Saccharomyces cerevisiae an ideal model organism for studying proteins like YML099W-A?

S. cerevisiae serves as an excellent model for studying uncharacterized proteins for several key reasons:

  • It is one of the most intensively studied eukaryotic model organisms in molecular and cell biology, comparable to Escherichia coli as the model bacterium .

  • The availability of the S. cerevisiae genome sequence and a set of deletion mutants covering 90% of the yeast genome enhances research capabilities .

  • Many proteins important in human biology were first discovered by studying their homologs in yeast, including cell cycle proteins, signaling proteins, and protein-processing enzymes .

  • S. cerevisiae reproduces rapidly and can be easily manipulated genetically, allowing for efficient experimental protocols.

  • The comprehensive model of genetic interactions covering ~75% of all genes in budding yeast provides context for understanding new proteins .

These advantages make S. cerevisiae particularly valuable for characterizing previously unstudied proteins like YML099W-A.

What are the standard methods for purifying recombinant YML099W-A protein?

Based on available information, recombinant YML099W-A is typically expressed in E. coli expression systems with a His-tag for purification purposes . The standard purification workflow would follow these methodological steps:

  • Expression optimization: Determining optimal conditions (temperature, induction time, media composition) for expression in E. coli.

  • Cell lysis: Disruption of bacterial cells using methods such as sonication, French press, or chemical lysis.

  • Affinity chromatography: Utilizing the His-tag for purification with nickel or cobalt resin columns.

    • Binding: Applying clarified lysate to the column in appropriate buffer conditions

    • Washing: Removing non-specifically bound proteins

    • Elution: Using imidazole gradient to recover purified protein

  • Secondary purification: If higher purity is required, employing size exclusion chromatography or ion exchange chromatography.

  • Quality control: Analyzing purity through SDS-PAGE, Western blotting, and potentially mass spectrometry.

  • Functional testing: Assessing protein activity through appropriate biochemical assays.

This methodological approach ensures obtaining high-quality protein suitable for downstream structural and functional characterization.

How does one verify the identity and integrity of purified YML099W-A?

Verification of recombinant YML099W-A requires a multi-faceted approach using complementary analytical techniques:

Verification MethodPurposeExpected Results for YML099W-A
SDS-PAGESize verificationSingle band at ~12-15 kDa (109 aa + His-tag)
Western BlotSpecific detectionRecognition by anti-His antibody
Mass SpectrometryAccurate mass and sequence confirmationMass matching predicted value; peptide coverage
Circular DichroismSecondary structure analysisSpectral characteristics of folded protein
Size Exclusion ChromatographyOligomeric state assessmentElution volume corresponding to monomeric or native state
N-terminal SequencingVerification of intact N-terminusMatching to predicted sequence
Dynamic Light ScatteringHomogeneity assessmentMonodisperse population

These methods collectively provide comprehensive validation of protein identity, purity, and structural integrity before proceeding to functional studies.

What bioinformatic approaches can predict potential functions of YML099W-A?

For uncharacterized proteins like YML099W-A, bioinformatic predictions serve as the foundation for experimental design. Key approaches include:

  • Sequence homology analysis: Identifying similar proteins across species using BLAST, HHpred, or HMMER to infer potential functions.

  • Domain prediction: Tools like Pfam, SMART, and InterPro can identify conserved functional domains within the protein sequence.

  • Structural prediction: AlphaFold2 or I-TASSER can generate structural models that may suggest function based on structural similarity.

  • Phylogenetic analysis: Examining evolutionary relationships to characterized proteins across species.

  • Co-expression analysis: Identifying genes with similar expression patterns in large datasets, suggesting functional relationships.

  • Genetic interaction network integration: Positioning YML099W-A within the yeast genetic interaction network by comparing to genes with known functions .

  • Subcellular localization prediction: Tools like PSORT can predict cellular compartmentalization, providing functional clues.

These complementary approaches generate testable hypotheses about YML099W-A's function that can guide experimental design.

What experimental designs are most effective for determining YML099W-A function?

Effective experimental design for characterizing YML099W-A should follow systematic principles outlined in experimental methodology . A comprehensive approach would include:

  • Define clear variables:

    • Independent variable: Manipulation of YML099W-A (knockout, overexpression, mutation)

    • Dependent variables: Measurable outcomes (growth rate, stress response, gene expression)

    • Control variables: Genetic background, environmental conditions

  • Generate specific hypotheses based on bioinformatic predictions about YML099W-A's function .

  • Design complementary experimental approaches:

    • Genetic approach: Create knockout and overexpression strains

    • Biochemical approach: Identify interaction partners and enzymatic activities

    • Cell biological approach: Determine subcellular localization and dynamics

    • Phenotypic approach: Characterize under various environmental conditions

  • Integrate with systems biology:

    • Synthetic genetic array analysis to identify genetic interactions

    • Transcriptomic analysis of knockout/overexpression strains

    • Proteomics to identify physical interaction networks

  • Validation experiments: Confirm findings through targeted follow-up studies with appropriate controls .

This multi-faceted experimental design follows best practices for causal relationship studies while leveraging the powerful genetic tools available in S. cerevisiae .

How can synthetic genetic array analysis be applied to understand YML099W-A function?

Synthetic genetic array (SGA) analysis represents a powerful approach for functionally characterizing uncharacterized proteins in yeast. Based on methodologies described in the literature , a comprehensive SGA analysis for YML099W-A would entail:

  • Creation of query strain: Generate a YML099W-A deletion strain marked with a selectable marker.

  • Systematic crossing: Cross the query strain with the yeast deletion collection (~4,800 non-essential gene deletions) using robotic platforms.

  • Double mutant selection: Select for haploid double-mutant progeny using appropriate marker combinations.

  • Quantitative phenotyping: Measure colony sizes as a proxy for fitness of each double mutant.

  • Genetic interaction scoring: Calculate genetic interaction scores based on deviation from expected fitness:

    • Negative interactions (synthetic sick/lethal): Worse than expected fitness

    • Positive interactions (suppressive): Better than expected fitness

  • Profile comparison: Compare YML099W-A's genetic interaction profile with profiles of known genes .

  • Functional prediction: Infer function based on genes with similar profiles, as "genes with similar genetic interaction profiles tend to be part of the same pathway or biological process" .

  • Network integration: Position YML099W-A within the global functional map of cellular processes .

This approach has been demonstrated to successfully characterize previously uncharacterized genes, with the comprehensive model covering ~75% of all genes in budding yeast constructed from 5.4 million two-gene comparisons .

How might YML099W-A be involved in yeast cellular processes based on current knowledge?

While specific information about YML099W-A's function is limited in the provided search results, we can outline methodological approaches to investigate its potential involvement in key cellular processes described for S. cerevisiae:

  • Cell division and cytokinesis:

    • Investigate potential interactions with the actomyosin ring (AMR) or primary septum (PS) formation machinery

    • Analyze localization during different cell cycle stages

    • Examine phenotypic effects of YML099W-A deletion on cytokinesis

  • Aging and lifespan regulation:

    • Measure replicative life span (RLS) and chronological life span (CLS) in YML099W-A mutants

    • Test genetic interactions with known aging regulators like sir2, fob1, or TOR pathway components

    • Examine response to calorie restriction, which affects aging in yeast

  • DNA repair and recombination:

    • Test sensitivity of YML099W-A mutants to DNA-damaging agents

    • Analyze genetic interactions with rad52 and other DNA repair genes

    • Measure recombination rates in YML099W-A mutants

  • Gene regulation and expression:

    • Perform transcriptomic analysis of YML099W-A deletion strains

    • Test for potential DNA or RNA binding capacity

    • Examine localization relative to transcriptional machinery

This systematic investigation would help position YML099W-A within known cellular processes or potentially identify novel functions.

What challenges exist in characterizing putative proteins and how can they be addressed?

Characterizing putative uncharacterized proteins like YML099W-A presents several methodological challenges that require specific strategies:

ChallengeMethodological Solution
Lack of obvious homology to known proteinsEmploy sensitive homology detection methods (PSI-BLAST, HHpred); structural predictions; focus on conserved motifs rather than global similarity
Potential redundancy with other genesCreate multiple gene knockouts; perform experiments under stress conditions that may reveal phenotypes
Low expression levelsUse sensitive detection methods; consider overexpression studies; examine expression under various conditions
Complex genetic interactionsApply systematic genetic interaction mapping as described in yeast genomic studies
Condition-specific functionsTest multiple environmental conditions and stressors; examine through yeast lifecycle phases
Transient or weak protein interactionsUse crosslinking approaches; employ sensitivity-enhanced detection methods; consider proximity labeling techniques
Structural challenges for recombinant expressionTest multiple expression systems; optimize solubility with different tags and conditions
Integration of disparate data typesDevelop computational frameworks to integrate genetic, physical, and phenotypic data

These methodological approaches leverage the advantages of S. cerevisiae as a model system, particularly the availability of comprehensive deletion collections and genetic interaction data , while addressing the specific challenges of uncharacterized protein research.

How can comparative genomics and evolutionary analysis inform YML099W-A research?

Comparative genomics and evolutionary analysis provide valuable context for understanding uncharacterized proteins. For YML099W-A research, these approaches would include:

  • Cross-species comparison:

    • Identify homologs across fungal species and potentially in more distant eukaryotes

    • Analyze conservation patterns to identify functionally important regions

    • Compare gene neighborhood (synteny) across related species

  • Evolutionary rate analysis:

    • Calculate selection pressure (dN/dS ratio) across the protein sequence

    • Identify conserved vs. rapidly evolving regions

    • Infer functional constraints from evolutionary conservation patterns

  • Functional inference from characterized homologs:

    • Test for functional complementation across species

    • Transfer functional annotations from well-studied homologs

    • Identify organisms where homologs have been experimentally characterized

  • Convergent evolution analysis:

    • Identify proteins with similar functions but different evolutionary origins

    • Use structural similarity searches beyond sequence homology

  • Integration with yeast evolution data:

    • Examine conservation across natural S. cerevisiae strains

    • Consider outcrossing frequency (~once every 50,000 cell divisions) and its impact on gene conservation

This evolutionary perspective can prioritize regions for mutational analysis and generate hypotheses about YML099W-A's biological importance based on selective pressures throughout evolution.

What considerations are important when designing mutation studies of YML099W-A?

Designing effective mutation studies for YML099W-A requires systematic planning based on experimental design principles :

This structured approach ensures that mutation studies generate interpretable results that can meaningfully contribute to understanding YML099W-A function.

How can researchers integrate YML099W-A studies into broader yeast systems biology?

Integrating YML099W-A research into systems biology frameworks requires methodological approaches that connect individual protein function to cellular systems:

  • Network integration:

    • Position YML099W-A within the genetic interaction network described in yeast studies

    • Map physical interactions using proteomics approaches

    • Integrate with metabolic networks if relevant

  • Multi-omics data integration:

    • Combine transcriptomic, proteomic, and metabolomic data from YML099W-A mutants

    • Apply computational approaches to identify perturbed pathways

    • Use machine learning to predict functional relationships

  • Pathway modeling:

    • Develop mathematical models incorporating YML099W-A into relevant pathways

    • Test predictions with targeted experiments

    • Refine models iteratively with experimental data

  • Contribution to the functional map:

    • Add YML099W-A data to the global functional map of cellular processes

    • Identify genes with similar interaction profiles to infer pathway membership

    • Connect to broader cellular functions like aging, DNA repair, or cytokinesis

  • Community resource development:

    • Standardize data collection and sharing methodologies

    • Contribute findings to yeast databases and resources

This systems-level integration transforms individual protein characterization into broader understanding of cellular function, leveraging the comprehensive interaction maps available for S. cerevisiae .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.