Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YML101C-A (YML101C-A)

Shipped with Ice Packs
In Stock

Description

Domain Architecture

YML101C-A contains a CUE domain (residues 20–60), which facilitates ubiquitin binding and may regulate intramolecular monoubiquitination processes . This domain is shared with its paralog CUE1, suggesting evolutionary conservation in ubiquitin-related pathways .

Cellular Localization

The protein is membrane-associated, though its specific subcellular compartment remains unconfirmed .

Stress Response Role

Transcriptomic studies reveal that YML101C-A is upregulated 2.45-fold in iron-resistant S. cerevisiae mutants, implicating it in metal-stress adaptation . This aligns with its interaction partners in pathways linked to environmental stress responses .

Recombinant Production

Commercially available variants include:

Product CodeSourceTagPurity
CSB-CF734919SVG E. coliN-terminal 10xHis>90% (SDS-PAGE)
RFL14398SF E. coliN-terminal His>90% (SDS-PAGE)

These products are utilized in:

  • Protein-protein interaction studies (e.g., yeast two-hybrid screens)

  • Structural analysis of CUE domain functionality

  • Metal-stress response assays

Limitations and Future Directions

Despite its utility, YML101C-A’s exact biochemical role remains uncharacterized. Current hypotheses focus on its ubiquitin-binding capacity and stress adaptation mechanisms . Future studies could employ CRISPR-based knockout models or high-resolution structural techniques (e.g., cryo-EM) to elucidate its function.

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YML101C-A; YML102C-A; Putative uncharacterized protein YML101C-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YML101C-A
Target Protein Sequence
MYRIKYIKNHKSTGVGCMRLFLLSLLLQGIFFTGSMFTIPPASRWFLAATALSSVSSGSA CIAGGSILEPNCVSVSIDTYEQNPSVDEISRVEPSSDHAKSVMGE
Uniprot No.

Target Background

Database Links

STRING: 4932.YML101C-A

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for studying YML101C-A in S. cerevisiae?

For effective expression of YML101C-A, several yeast expression vectors can be utilized, with selection depending on your specific research goals:

  • Constitutive expression systems: The GPD (glyceraldehyde-3-phosphate dehydrogenase) promoter provides strong, continuous expression ideal for initial characterization studies .

  • Inducible expression systems: GAL1 promoter allows for controlled expression by switching between glucose (repressed) and galactose (induced) media, helpful when studying proteins that might be toxic when overexpressed .

  • Integration-based systems: For stable expression with less copy number variation, consider chromosomal integration using vectors like pRS series that contain yeast selectable markers .

When expressing recombinant proteins in yeast, it's crucial to optimize codon usage for S. cerevisiae to ensure efficient translation. Expression can be verified through RNA-Seq to quantify transcript levels, which provides a more sensitive measurement than traditional methods .

How can I effectively characterize the basic properties of YML101C-A?

Characterizing an uncharacterized protein like YML101C-A requires a systematic approach:

  • Sequence analysis:

    • Primary structure assessment using bioinformatics tools

    • Domain prediction to identify conserved functional regions

    • Homology modeling if structural homologs exist

  • Expression profiling:

    • RNA-Seq analysis under various conditions to determine expression patterns

    • Technical replicates are essential to distinguish measurement imprecision from biological variance

    • Consider differential expression analysis across growth phases and stress conditions

  • Protein characterization:

    • Size determination via SDS-PAGE

    • Post-translational modifications analysis using mass spectrometry

    • Stability assessment under varying pH and temperature conditions

For RNA-Seq data analysis, uniquely aligned reads should be prioritized to ensure accurate quantification, as highlighted in comprehensive transcriptome studies of S. cerevisiae .

What controls should be included when studying an uncharacterized protein like YML101C-A?

A robust experimental design for studying YML101C-A requires comprehensive controls:

Control TypePurposeImplementation
Positive controlsVerify assay functionalityInclude well-characterized proteins with similar properties
Negative controlsEstablish background signalsEmpty vector transformants; unrelated proteins
Technical controlsAccount for methodology biasReplicate measurements from the same biological sample
Biological replicatesMeasure natural variationIndependent cultures grown under identical conditions
Condition controlsEstablish baseline expressionWild-type strain under standard growth conditions

When analyzing RNA-Seq data, it's important to understand that both technical variance (measurement imprecision) and biological variance (true expression differences between samples) contribute to observed differences . For reliable results, both types of replicates should be included in your experimental design.

What experimental approaches can determine the function of YML101C-A?

Determining the function of an uncharacterized protein requires multiple complementary approaches:

  • Gene deletion/disruption:

    • Create knockout strains and analyze resulting phenotypes

    • Perform growth assays under various conditions to identify functional relevance

    • Quantify fitness effects using competitive growth experiments

  • Protein-protein interaction studies:

    • Yeast two-hybrid screening to identify interaction partners

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Proximity-dependent biotin identification (BioID) to capture transient interactions

  • Localization studies:

    • C- or N-terminal tagging with fluorescent proteins

    • Subcellular fractionation followed by Western blotting

    • Immunofluorescence microscopy using protein-specific antibodies

  • Transcriptional profiling:

    • RNA-Seq analysis comparing wild-type and deletion strains

    • Consider biological replicates to account for expression variability

    • Analyze data using proper statistical methods that account for both Poisson and non-Poisson variance

When designing these experiments, it's critical to consider the potential impact of tags or modifications on protein function, and to validate findings using multiple independent approaches.

How can I use DNA-binding assays to determine if YML101C-A is a transcription factor?

If sequence analysis suggests YML101C-A may function as a DNA-binding protein or transcription factor, several methods can confirm this property:

  • Electrophoretic Mobility Shift Assay (EMSA):

    • Incubate purified YML101C-A with labeled DNA fragments

    • Analyze mobility shifts indicating protein-DNA complex formation

    • Confirm binding specificity through competition with unlabeled DNA probes

    • Validate protein identity using antibodies in supershift assays

  • Yeast One-Hybrid Assay:

    • This approach tests if YML101C-A can activate transcription when bound to specific DNA sequences

    • Advantages include testing in the native cellular environment of yeast

    • Higher success rate than E. coli-based systems for eukaryotic transcription factors

    • Limitation: does not test binding at native genomic loci

  • ChIP-Seq (Chromatin Immunoprecipitation followed by sequencing):

    • Maps protein-DNA interactions genome-wide

    • Requires specific antibodies or tagged versions of YML101C-A

    • Provides in vivo binding data under physiological conditions

  • DNA-binding domain analysis:

    • Computational prediction based on protein sequence analysis

    • Compare to known transcription factor databases like DBD

    • Note that computational predictions may include false positives/negatives

EMSA offers high sensitivity, detecting femtomole quantities of transcription factors, making it suitable for initial characterization of DNA-binding properties .

What approaches can identify the RNA expression patterns of YML101C-A across different conditions?

To characterize the expression patterns of YML101C-A:

  • RNA-Seq analysis:

    • Quantify transcript levels across different conditions

    • Consider both technical and biological replicates for reliable measurements

    • Account for both Poisson (sampling) and non-Poisson (technical and biological) variance

    • Ensure sufficient sequencing depth to detect low-abundance transcripts

  • Quantitative considerations for RNA-Seq:

    • Use only uniquely aligned reads to avoid measurement errors

    • Consider gene length and GC content when comparing expression levels

    • Calculate FPKM or TPM values for normalized expression comparisons

    • Apply appropriate statistical tests for differential expression analysis

  • Time-course experiments:

    • Measure expression changes during:

      • Different growth phases

      • Stress responses

      • Metabolic shifts

    • Analyze patterns to infer regulatory mechanisms

  • Single-cell RNA-Seq:

    • Capture expression heterogeneity within populations

    • Identify subpopulations with distinct expression profiles

    • Understand stochastic expression patterns

When analyzing RNA-Seq data, it's critical to recognize that true expression levels form distributions and multiple measurements are necessary to accurately estimate these distributions .

How can I use recombinant yeast systems to study protein-protein interactions of YML101C-A?

Yeast provides excellent platforms for studying protein-protein interactions:

  • Yeast two-hybrid (Y2H) system:

    • Fuse YML101C-A to a DNA-binding domain (bait)

    • Screen against prey proteins fused to activation domains

    • Interactions reconstitute a functional transcription factor

    • Advantages: relatively simple setup, genome-wide screening capability

    • Limitations: high false positive/negative rates, requires nuclear localization

  • Protein complementation assays (PCA):

    • Split reporter proteins (e.g., split-ubiquitin, split-GFP)

    • Fusion proteins reconstitute reporter activity when interacting

    • Advantages: can detect interactions in native compartments

    • Applications: membrane protein interactions, cytoplasmic complex formation

  • Affinity purification coupled with mass spectrometry:

    • Express tagged YML101C-A in yeast

    • Purify under native conditions to maintain interactions

    • Identify binding partners by mass spectrometry

    • Quantitative approaches (SILAC, TMT) can determine interaction dynamics

  • Genetic interaction screens:

    • Synthetic genetic array (SGA) analysis

    • Create double mutants with YML101C-A deletion

    • Identify genes with synergistic phenotypes indicating functional relationships

These methods are complementary and should ideally be combined to overcome the limitations of individual approaches.

What immunological applications could utilize recombinant YML101C-A expressed in yeast?

While YML101C-A itself may not have direct immunological applications, the principles of recombinant yeast-based immunological systems can be applied:

  • Antigen presentation systems:

    • Recombinant yeast can effectively deliver antigens for vaccine development

    • S. cerevisiae represents a safe delivery vehicle that can be administered multiple times

    • Yeast cells expressing recombinant proteins can activate dendritic cells (DCs)

    • This approach causes rapid increases in MHC class II+ cells and antigen-presenting cells in draining lymph nodes

  • Immune response measurement:

    • Yeast-expressed proteins can elevate MHC class I and II molecules on DCs

    • Post-treatment with recombinant yeast increases costimulatory molecules and DC maturation markers

    • This leads to secretion of Type I inflammatory cytokines

  • Potential applications for YML101C-A:

    • If YML101C-A contains immunogenic epitopes, it could be studied as a model antigen

    • Functional studies could examine specific activation of T cells in an MHC-restricted manner

    • Expression systems could be optimized based on findings from other recombinant yeast systems

The scientific rationale for using recombinant yeast in vaccination protocols is well-established, with demonstrated safety and efficacy in multiple host administrations .

How should I approach experimental design when studying expression variability of YML101C-A?

When studying expression variability:

  • Replicate design considerations:

    • Technical replicates: Process the same biological sample through independent preparations and sequencing

    • Biological replicates: Separate cultures grown independently and processed separately

    • Minimum of three biological replicates recommended for statistical power

  • Variance components to consider:

    • Poisson sampling noise: Inherent in RNA-Seq count data

    • Non-Poisson technical variance: From library preparation and sequencing

    • Biological variance: True expression differences between samples

  • Experimental controls:

    • Spike-in controls for normalization

    • Housekeeping genes as internal references

    • Empty vector controls for background expression

  • Statistical analysis approach:

    • Use models that account for both Poisson and non-Poisson variance components

    • Consider gene-specific dispersion patterns

    • Apply appropriate multiple testing corrections

Understanding that different RNA types may exhibit different variance characteristics in technical replicates is important; for example, snoRNAs show greater variance than coding genes in whole transcriptome sequencing .

How can I integrate multi-omics data to comprehensively understand YML101C-A function?

Multi-omics data integration provides a more complete picture of protein function:

  • Data types to integrate:

    • Transcriptomics: RNA-Seq data for expression patterns

    • Proteomics: Mass spectrometry for protein levels and modifications

    • Metabolomics: Metabolite profiles affected by YML101C-A

    • Interactomics: Protein-protein and protein-DNA interaction networks

    • Phenomics: Systematic phenotype data from deletion/mutation strains

  • Integration approaches:

    • Correlation analysis across data types

    • Network-based integration (protein-protein interaction networks)

    • Machine learning models to predict function from multi-modal data

    • Pathway enrichment analysis across different data types

  • Visualization strategies:

    • Multi-layer network visualization

    • Integrated heatmaps showing relationships across datasets

    • Principal component analysis to reduce dimensionality

    • Interactive dashboards for exploring complex relationships

  • Validation of integrated findings:

    • Targeted experimental validation of predictions

    • Cross-validation using independent datasets

    • Literature-based validation of similar proteins

When analyzing RNA-Seq data as part of your multi-omics approach, ensure you're accounting for both technical and biological variation to get accurate expression measurements .

What statistical approaches are appropriate for analyzing conflicting data regarding YML101C-A function?

When faced with conflicting data:

  • Comprehensive meta-analysis:

    • Systematically compare methodologies used in conflicting studies

    • Weight evidence based on experimental rigor and reproducibility

    • Identify potential sources of discrepancies (strain differences, growth conditions)

  • Statistical approaches for reconciliation:

    • Bayesian methods to update beliefs based on new evidence

    • Random-effects models to account for between-study heterogeneity

    • Sensitivity analysis to identify influential factors driving differences

    • Power analysis to determine if discrepancies might be due to sample size differences

  • Experimental validation strategies:

    • Design experiments specifically addressing methodological differences

    • Use orthogonal techniques to validate findings

    • Control for strain background effects and growth conditions

    • Include positive and negative controls to calibrate results

  • Accounting for RNA-Seq specific challenges:

    • For expression data conflicts, examine:

      • Sequencing depth differences

      • Biological vs. technical variance contributions

      • Read alignment strategies (unique vs. multi-mapping reads)

      • Normalization methods used

When analyzing RNA-Seq data, it's important to understand that differences in expression levels between samples comprise both true biological differences and measurement imprecision .

How can computational modeling help predict the functions of YML101C-A?

Computational approaches offer powerful methods for function prediction:

  • Sequence-based predictions:

    • Homology modeling based on sequence similarity

    • Domain architecture analysis for functional inference

    • Motif identification and comparison to known functional motifs

    • Disorder prediction to identify flexible regions

  • Structure-based approaches:

    • Ab initio protein structure prediction

    • Molecular docking to predict interaction partners

    • Binding site identification and characterization

    • Molecular dynamics simulations to study conformational dynamics

  • Systems biology approaches:

    • Network-based function prediction using guilt-by-association

    • Gene co-expression analysis to identify functionally related genes

    • Enrichment analysis of interacting partners

    • Flux balance analysis to predict metabolic roles

  • Machine learning methods:

    • Supervised learning using labeled proteins with known functions

    • Feature extraction from multiple data sources

    • Transfer learning from well-characterized proteins

    • Deep learning approaches for complex pattern recognition

Computational predictions should be treated as hypotheses that require experimental validation, as false positives and negatives are common, especially for proteins with limited similarity to well-characterized proteins .

What emerging technologies could advance our understanding of YML101C-A?

Several cutting-edge technologies show promise for uncharacterized protein research:

  • CRISPR-based technologies:

    • Base editing for precise mutation introduction

    • CRISPRi/CRISPRa for reversible functional studies

    • Prime editing for targeted modifications without double-strand breaks

    • CRISPR screens for high-throughput functional genomics

  • Advanced imaging techniques:

    • Super-resolution microscopy for detailed localization

    • Single-molecule tracking to follow dynamics in living cells

    • Correlative light and electron microscopy (CLEM)

    • Live-cell imaging with improved temporal resolution

  • Structural biology advancements:

    • Cryo-electron microscopy for near-atomic resolution

    • Integrative structural biology combining multiple data sources

    • AlphaFold and related AI approaches for structure prediction

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Single-cell technologies:

    • Single-cell RNA-Seq for expression heterogeneity

    • Single-cell proteomics for protein-level analysis

    • Spatial transcriptomics for localized expression patterns

    • Multi-modal single-cell analysis combining genomics and proteomics

These technologies will enable more detailed characterization of protein function, localization, and dynamics, potentially revealing roles for YML101C-A that cannot be detected with current methods.

How might studying YML101C-A contribute to our broader understanding of yeast biology?

Investigating uncharacterized proteins like YML101C-A can advance yeast biology in several ways:

  • Completing the functional genome map:

    • Despite extensive study, many yeast genes remain uncharacterized

    • Understanding YML101C-A adds to our comprehensive knowledge

    • May reveal novel cellular pathways or mechanisms

    • Contributes to systems-level understanding of cellular function

  • Evolutionary insights:

    • Comparative genomics across yeast species can reveal conservation patterns

    • May identify species-specific adaptations or core cellular machinery

    • Helps understand protein evolution and functional divergence

    • Could reveal ancient cellular functions preserved across eukaryotes

  • Network biology advancement:

    • Mapping YML101C-A interactions completes cellular interaction networks

    • Identifies new connections between known pathways

    • Improves predictive power of whole-cell models

    • Reveals emergent properties not evident from individual component studies

  • Biotechnological applications:

    • Novel proteins may have unique properties useful for biotechnology

    • Understanding all yeast proteins improves metabolic engineering efforts

    • May reveal new tools for synthetic biology applications

    • Could lead to improved yeast strains for industrial processes

The knowledge gained from studying individual uncharacterized proteins contributes to the broader goal of complete functional annotation of model organisms.

What cross-disciplinary approaches might yield new insights into YML101C-A function?

Integrating methods from multiple disciplines can drive discovery:

  • Biophysics + biochemistry:

    • Single-molecule biophysics to study protein dynamics

    • Label-free interaction methods to identify binding partners

    • In vitro reconstitution of protein complexes

    • Enzyme kinetics if enzymatic activity is discovered

  • Systems biology + computational modeling:

    • Multi-scale modeling from molecules to cells

    • Constraint-based modeling incorporating YML101C-A

    • Agent-based simulations of cellular processes

    • Network perturbation analysis to predict system-wide effects

  • Chemical biology + genetics:

    • Chemical-genetic profiling to identify functional interactions

    • Small molecule modulators as probes for function

    • Chemoproteomics to identify binding partners

    • Targeted degradation approaches (PROTACs, dTAG)

  • Evolutionary biology + comparative genomics:

    • Ancestral sequence reconstruction

    • Selection pressure analysis across yeast lineages

    • Horizontal gene transfer investigation

    • Paralog functional divergence studies

Cross-disciplinary approaches are particularly valuable for uncharacterized proteins where standard methods may have failed to reveal function, providing new perspectives and methodological advantages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.