Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YMR052C-A (YMR052C-A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks; we will accommodate your request as much as possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
YMR052C-A; Putative uncharacterized protein YMR052C-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YMR052C-A
Target Protein Sequence
MILWGGSGGYLVIILYTIMPVKTIEEYEYDFFRFILIFFFFQKGSKHLSVVISILKYINA FKGLLFHVCLHFCSIHRRLFQYLVRVLQVFQLFFKAAVISGIFRYTIPIHFLQKFFKLFD N
Uniprot No.

Target Background

Database Links

STRING: 4932.YMR052C-A

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the primary approaches for initial characterization of YMR052C-A protein expression in Saccharomyces cerevisiae?

The initial characterization of YMR052C-A expression requires a systematic approach combining genomic verification and protein detection. Begin with genomic DNA extraction from recombinant yeast strains following the Looke protocol or similar methods, followed by PCR amplification using primers specific to the YMR052C-A sequence . For protein expression confirmation, employ a multi-method verification strategy including:

  • Western blotting using anti-His tag antibodies if the construct contains a His-tag

  • Immunofluorescence assay to visualize protein localization

  • Flow cytometry for quantitative expression analysis

Expression kinetics should be monitored at multiple time points (typically days 1-5) to determine optimal expression patterns, as protein accumulation may continue well into the stationary phase of growth . When designing primers, ensure they flank the entire coding region to verify the full sequence integrity.

How does the growth medium composition affect the expression of recombinant YMR052C-A in Saccharomyces cerevisiae?

The growth medium composition significantly impacts both the yield and quality of recombinant YMR052C-A expression. In standard yeast extract-peptone-dextrose (YPD) medium, expression typically follows the growth curve with maximum protein accumulation occurring during late logarithmic and stationary phases . For optimization, consider the following media modifications:

Medium ComponentStandard ConcentrationOptimized RangeEffect on YMR052C-A Expression
Glucose2%1-4%Higher concentrations increase protein yield but may impact proper folding
Peptone2%1-3%Affects amino acid availability for protein synthesis
Yeast Extract1%0.5-2%Provides essential cofactors for proper protein maturation
pH6.05.5-6.5Impacts protein stability and cellular metabolism

For induction timing, initiate culture in standard YPD and monitor growth spectrophotometrically. Protein expression should increase gradually during the first 2-3 days of culture, reaching maximum levels typically by day 5, though this varies with specific strains and constructs . Temperature maintenance at 30°C is critical throughout this period to ensure optimal enzyme activity and protein folding.

What techniques are most effective for purifying YMR052C-A for functional studies?

For effective purification of YMR052C-A, a multi-step approach is recommended based on the protein's properties and expression system design. When the protein is expressed with a hexahistidine tag, immobilized metal affinity chromatography (IMAC) serves as an effective first purification step. The procedure should be conducted as follows:

  • Harvest yeast cells by centrifugation at 5,000 × g for 10 minutes

  • Disrupt cell walls using glass bead homogenization or enzymatic lysis

  • Clear lysate by centrifugation at 10,000 × g for 20 minutes

  • Apply supernatant to Ni-NTA column pre-equilibrated with binding buffer

  • Wash with increasing concentrations of imidazole (10-30 mM)

  • Elute protein with 250-300 mM imidazole buffer

For higher purity, implement secondary purification steps such as ion exchange chromatography or size exclusion chromatography. Consider the potential glycosylation of YMR052C-A when designing purification strategies, as yeast-expressed proteins often display band sizes larger than predicted due to post-translational modifications . Verification of purified protein should include SDS-PAGE, Western blotting, and if applicable, functional assays specific to the predicted activity of YMR052C-A.

How can surface display systems be optimized for studying YMR052C-A functionality in Saccharomyces cerevisiae?

The Aga1-Aga2 anchor system provides an efficient approach for surface display of YMR052C-A in Saccharomyces cerevisiae. For optimal surface expression, the YMR052C-A coding sequence should be cloned into an appropriate vector (such as pGPD-ADH1-POT) using overlapping PCR with primers containing homologous sequences to the vector . The expression construct should include:

  • A strong constitutive promoter (GPD promoter recommended)

  • The Aga2 protein fused to the N-terminus of YMR052C-A

  • A detection tag (His-tag) at the C-terminus

  • The ADH1 terminator sequence for proper transcription termination

The functional module GPDp-(Aga2-YMR052C-A)-ADH1t ensures effective surface display, which can be verified through:

  • Western blot analysis using both anti-His tag and protein-specific antibodies

  • Immunofluorescence microscopy to confirm surface localization

  • Flow cytometry for quantitative assessment of display efficiency

Maximizing expression requires optimization of culture conditions through time-course studies to determine peak expression points. Monitoring should include both cell growth (by spectrophotometric methods) and protein expression (by Western blot) over a 5-day period to identify optimal harvest time . This surface display approach facilitates functional studies including protein-protein interactions, enzymatic activity, and structural analysis without the need for cell disruption.

What experimental approaches can reveal the potential cellular functions of YMR052C-A in Saccharomyces cerevisiae?

To uncover the cellular functions of the uncharacterized YMR052C-A protein, a comprehensive multi-omics experimental strategy is required. Begin with gene deletion studies using CRISPR-Cas9 or traditional homologous recombination approaches to generate knockout strains. Compare these with wild-type and overexpression strains under various growth conditions to assess phenotypic changes. Key experimental approaches include:

ApproachMethodologyExpected Insights
TranscriptomicsRNA-Seq analysis of knockout vs. wild-type strainsGenes up/down-regulated in response to YMR052C-A absence
ProteomicsLC-MS/MS analysis of protein changesProtein interaction networks affected
MetabolomicsGC-MS or LC-MS analysis of metabolite profilesMetabolic pathways influenced by YMR052C-A
Phenotypic ArraysGrowth under various stressors (temperature, pH, oxidative)Functional role in stress response
Protein LocalizationFluorescent tagging and microscopySubcellular compartment where function occurs

For interaction studies, employ yeast two-hybrid screening or co-immunoprecipitation followed by mass spectrometry to identify protein binding partners. Complementation studies with orthologs from related species can provide additional functional insights. When designing experiments, ensure proper experimental controls and use a between-subjects design with multiple biological replicates to establish statistical significance .

How does post-translational modification affect the structure and function of YMR052C-A protein?

Post-translational modifications (PTMs) of YMR052C-A likely play crucial roles in determining its structure-function relationships. In Saccharomyces cerevisiae, glycosylation is a prominent PTM that can significantly alter protein size, as observed in similar recombinant yeast proteins displaying larger apparent molecular weights than predicted from amino acid sequence alone . To systematically investigate PTMs:

  • Identify potential glycosylation sites using bioinformatic prediction tools (NetNGlyc, NetOGlyc)

  • Verify glycosylation experimentally through:

    • Treatment with endoglycosidases (PNGase F, Endo H)

    • Periodic acid-Schiff (PAS) staining

    • Lectin binding assays

  • Assess phosphorylation status using:

    • Phospho-specific antibodies

    • Phos-tag SDS-PAGE

    • LC-MS/MS analysis after phosphopeptide enrichment

For comprehensive PTM mapping, employ a proteomic approach using high-resolution mass spectrometry. This should be conducted on purified YMR052C-A protein from various growth phases and conditions to identify condition-specific modifications. Structure-function relationships can be further explored by creating site-directed mutants at PTM sites and assessing functional consequences through appropriate activity assays. This methodological approach will provide insights into how PTMs regulate YMR052C-A's cellular roles.

What is the optimal experimental design for studying the effects of environmental stressors on YMR052C-A expression?

When investigating environmental stress responses of YMR052C-A, implement a factorial experimental design that systematically varies multiple stress factors while measuring expression levels. This approach requires:

  • Clearly defined independent variables (stressors such as temperature, osmolarity, pH, oxidative agents)

  • Precisely measured dependent variables (YMR052C-A expression levels via qRT-PCR, Western blotting, or reporter systems)

  • Control of extraneous variables (growth phase, media composition)

A recommended experimental design matrix:

Stress ConditionTemperature VariationsOsmotic Stress LevelsOxidative Stress ConcentrationsReplicates
Control30°C0% NaCl0 mM H₂O₂5
Heat Shock37°C, 42°C0% NaCl0 mM H₂O₂5 each
Osmotic Stress30°C0.5%, 1%, 1.5% NaCl0 mM H₂O₂5 each
Oxidative Stress30°C0% NaCl0.5, 1, 2 mM H₂O₂5 each
Combined Stressors37°C1% NaCl1 mM H₂O₂5

For time-course studies, collect samples at multiple time points (0, 15, 30, 60, 120 minutes) after stress induction. Employ both between-subjects and within-subjects components in your design to capture immediate responses and adaptation mechanisms . When analyzing results, use appropriate statistical methods such as ANOVA with post-hoc tests to identify significant differences across conditions and potential interaction effects between different stressors.

How should researchers design experiments to investigate potential protein-protein interactions of YMR052C-A?

To systematically investigate protein-protein interactions (PPIs) of YMR052C-A, employ a multi-method approach beginning with in silico predictions and progressing to experimental validation. The experimental design should include:

  • Primary screening methods:

    • Yeast two-hybrid (Y2H) assay with YMR052C-A as bait against a genomic library

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Proximity-dependent biotin identification (BioID)

  • Validation methods:

    • Co-immunoprecipitation (Co-IP) with specific antibodies

    • Bimolecular fluorescence complementation (BiFC)

    • Förster resonance energy transfer (FRET)

When designing these experiments, consider:

  • Use both N- and C-terminal tags to identify tag-position artifacts

  • Include appropriate positive and negative controls

  • Perform experiments under various physiological conditions

  • Apply stringent statistical filtering to minimize false positives

For Y2H experiments, use a between-subjects design with multiple selective conditions (increasing stringency) to identify high-confidence interactions . For AP-MS studies, implement SILAC (Stable Isotope Labeling with Amino acids in Cell culture) to differentiate specific from non-specific interactions. All interaction partners should be verified through reciprocal experiments and functional assays to establish biological relevance beyond physical interaction.

What methodological approaches are most effective for determining the subcellular localization of YMR052C-A?

Determining the subcellular localization of YMR052C-A requires a comprehensive approach combining fluorescent protein tagging, immunolocalization, and subcellular fractionation techniques. The methodological workflow should include:

  • Fluorescent protein fusion constructs:

    • Create both N- and C-terminal fusions with GFP/mCherry

    • Verify functionality of fusion proteins

    • Observe live cells using confocal microscopy

    • Co-localize with known organelle markers

  • Immunofluorescence microscopy:

    • Fix cells with 4% paraformaldehyde

    • Permeabilize with 0.1% Triton X-100

    • Incubate with primary antibodies against YMR052C-A

    • Detect with fluorophore-conjugated secondary antibodies

    • Co-stain with organelle-specific markers

  • Subcellular fractionation:

    • Isolate distinct cellular compartments through differential centrifugation

    • Analyze fractions by Western blotting

    • Quantify relative abundance in each compartment

Cellular CompartmentMarker ProteinCentrifugation ConditionExpected YMR052C-A Presence
NucleusHistone H31,000 × g, 10 minTo be determined
MitochondriaCytochrome c10,000 × g, 15 minTo be determined
ER/GolgiSec61100,000 × g, 60 min (pellet)To be determined
CytosolGAPDH100,000 × g, 60 min (supernatant)To be determined

How can researchers troubleshoot low expression levels of recombinant YMR052C-A in Saccharomyces cerevisiae?

Low expression of recombinant YMR052C-A can stem from multiple factors in the expression system. A systematic troubleshooting approach should address:

  • Genetic construct optimization:

    • Verify sequence integrity through full-length sequencing

    • Check codon optimization for Saccharomyces cerevisiae

    • Ensure promoter-gene-terminator junctions are correct

    • Consider alternative promoters (GPD, TEF, ADH1) if expression remains low

  • Expression conditions optimization:

    • Adjust culture temperature (25-30°C is optimal for protein folding)

    • Modify media composition (carbon source type and concentration)

    • Test different induction timing and duration

    • Monitor growth phases carefully as protein expression may peak at specific phases

  • Protein stability considerations:

    • Add protease inhibitors during extraction

    • Test reduced growth temperature (20-25°C) to improve folding

    • Consider fusion partners that enhance stability (thioredoxin, SUMO)

    • Analyze protein half-life using cycloheximide chase assays

If western blot detection is challenging, verify antibody specificity and consider epitope accessibility issues. For surface-displayed proteins using the Aga1-Aga2 system, ensure proper anchoring by comparing multiple detection methods (Western blot, immunofluorescence, and flow cytometry) . Time-course expression analysis is essential, as peak expression may occur later than anticipated (day 5 rather than day 2-3 in some constructs) .

What statistical approaches are most appropriate for analyzing differential expression of YMR052C-A under various experimental conditions?

For rigorous statistical analysis of YMR052C-A differential expression, the approach should align with your experimental design and data characteristics. When analyzing expression data:

  • For time-course experiments with multiple conditions:

    • Apply repeated measures ANOVA to account for within-subject variability

    • Use mixed-effects models for incomplete datasets

    • Implement time-series analysis techniques for temporal patterns

  • For dose-response or multiple treatment comparisons:

    • Use two-way ANOVA to assess main effects and interactions

    • Apply post-hoc tests (Tukey's HSD, Bonferroni) for multiple comparisons

    • Consider non-parametric alternatives (Kruskal-Wallis) if normality assumptions are violated

Statistical TestApplication ScenarioRequirementsAdvantages
Student's t-testTwo conditions comparisonNormal distribution, equal varianceSimple interpretation
ANOVAMultiple conditionsNormal distribution, independent samplesDetects differences across groups
MANOVAMultiple dependent variablesMultivariate normalityAccounts for correlations among outcomes
Linear mixed modelsRepeated measures with missing dataProperly specified random effectsHandles unbalanced designs

When designing experiments, ensure sufficient biological replicates (minimum n=5) to achieve adequate statistical power . For RNA-seq or proteomic analyses, employ specialized statistical frameworks like DESeq2 or limma that account for the specific characteristics of high-throughput data. Report both effect sizes and p-values, and control for multiple testing using Benjamini-Hochberg or similar procedures to maintain a false discovery rate below 0.05.

How should researchers interpret contradictory results when analyzing YMR052C-A function across different experimental approaches?

Contradictory results when studying YMR052C-A function are not uncommon and require systematic analysis to resolve. When faced with discrepancies between experimental approaches:

  • Evaluate methodological differences:

    • Compare detection sensitivity limits across techniques

    • Assess whether techniques measure different aspects of protein function

    • Examine potential artifacts introduced by tags or expression systems

    • Consider temporal aspects (acute vs. chronic effects)

  • Analyze contextual variables:

    • Growth conditions and media composition differences

    • Strain background genetic variations

    • Expression levels (overexpression vs. endogenous)

    • Cell cycle stage and metabolic state

  • Reconciliation strategies:

    • Design orthogonal validation experiments

    • Perform dose-response studies to identify threshold effects

    • Use complementary techniques that measure the same parameter

    • Implement genetic approaches (point mutations vs. complete deletions)

When analyzing contradictory results, create a comprehensive comparison table documenting all experimental variables that might influence outcomes. Consider whether differences reflect true biological complexity rather than experimental artifacts. For example, YMR052C-A might display different functions depending on its post-translational modification state, which could vary across experimental conditions.

For publication, transparently report all seemingly contradictory results and propose integrative models that accommodate the apparent discrepancies. This approach not only maintains scientific integrity but often leads to deeper insights into complex protein functions that manifest differently under varying cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.