Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YMR193C-A (YMR193C-A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
YMR193C-A; Putative uncharacterized protein YMR193C-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YMR193C-A
Target Protein Sequence
MFHLKAFSQYYSFCKMDLIFKHNSFLDRSEEISLCMHIKWYFSSGYFHWSLITQNYIIFL FLFPFKFSMHSCSSRIWGKPLYKFENRHNPFSSLFMSHIPVLTVISYCVCCLSCFFDTCK SVLYCSTS
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is YMR193C-A and why is it classified as a dubious open reading frame?

    YMR193C-A is identified as a dubious open reading frame in Saccharomyces cerevisiae that is unlikely to encode a functional protein, based on available experimental and comparative sequence data . This classification stems from bioinformatic analyses showing limited sequence conservation across related yeast species, atypical codon usage patterns, and lack of detection in proteomic studies. Dubious ORFs like YMR193C-A are genomic regions that contain potential protein-coding sequences but lack strong evidence of actual protein expression or function. Despite this classification, systematic deletion studies have been conducted with YMR193C-A to assess any potential phenotypic effects.

  • What experimental approaches are recommended for studying putative uncharacterized proteins in S. cerevisiae?

    A multi-faceted approach is essential for studying putative uncharacterized proteins like YMR193C-A:

    • Create deletion strains using drug-resistant markers as described in the Saccharomyces Cerevisiae Morphological Database methodology

    • Conduct phenotypic analysis in various conditions using growth rate measurements with absorbance-based assays in different media and stress conditions

    • Implement high-throughput microscopy and morphological analysis to reveal subtle phenotypes not apparent in growth assays

    • Perform synthetic genetic array (SGA) analysis to identify genetic interactions

    • Apply comparative genomics across closely related yeast species to determine sequence conservation

    • Utilize drug-hypersensitive genetic backgrounds to amplify subtle phenotypic effects

  • How can synthetic recombinant populations help in studying uncharacterized proteins like YMR193C-A?

    Synthetic recombinant populations provide powerful platforms for studying uncharacterized proteins through:

    • Maximizing genetic variation through techniques like pairwise crossing of isogenic strains, which is crucial for detecting phenotypic effects of putative genes

    • Enabling observation of how YMR193C-A interacts with different genetic contexts, revealing subtle phenotypic effects that might only manifest in specific genetic backgrounds

    • Facilitating experimental evolution approaches where populations undergo multiple cycles of outcrossing to reveal if YMR193C-A contributes to fitness under selection pressure

    • Supporting QTL mapping to identify associations between YMR193C-A and specific phenotypes

    • Allowing assessment of YMR193C-A function across diverse genetic backgrounds simultaneously, increasing the chance of detecting condition-specific or background-specific effects

  • What morphological data is available for YMR193C-A deletion mutants?

    The Saccharomyces Cerevisiae Morphological Database (SCMD) contains morphological data for YMR193C-A deletion mutants in drug-hypersensitive genetic backgrounds . This dataset includes:

    • Average morphological parameter data (16.9 MB)

    • Number of cells for ratio parameters (403 KB)

    • Number of cells in specimen for ratio parameter (491 MB)

    • Comparisons with 749 replicated wild-type (drug-hypersensitive strain) controls

    Cell images of the YMR193C-A mutants are available through links at the SCMD entry, allowing for further independent analysis of cellular morphology beyond the pre-calculated parameters provided in the database .

Advanced Research Questions

  • What methodologies are most effective for functional analysis of dubious open reading frames in yeast?

    Effective methodologies for analyzing dubious ORFs like YMR193C-A include:

    • Genome-wide deletion studies in drug-hypersensitive backgrounds to increase sensitivity for detecting subtle phenotypic effects

    • Overexpression analyses to reveal potential gain-of-function phenotypes

    • RNA-seq under various environmental conditions to determine if the ORF is transcribed and responds to environmental changes

    • Synthetic recombinant population approaches to detect context-dependent functions by introducing the presence/absence of the dubious ORF into diverse genetic backgrounds

    • Advanced microscopy techniques to detect subtle subcellular phenotypes

    • Comparative genomics across closely related yeast species to assess sequence conservation

    • Systematic environmental and chemical perturbation screens to identify condition-specific roles

  • How can crossing design strategies be optimized when studying phenotypic effects of YMR193C-A modifications?

    Research on synthetic recombinant S. cerevisiae populations provides valuable insights for optimizing crossing designs:

    • Implement pairwise crossing designs (S-type) rather than simple mixing (K-type), as they maintain more genetic variation

    • Increase the number of parental strains (from 4 to 8 to 12) to enhance genetic diversity, providing more genomic contexts to observe potential YMR193C-A effects

    • Ensure balanced representation of different genetic backgrounds by carefully selecting mating pairs and validating proper segregation of markers

    • Employ multiple cycles of intentional outcrossing (with sporulation, spore isolation, and mating) to allow extensive recombination, helping to break up linkage blocks and isolate YMR193C-A effects from nearby genes

    • Sequence at multiple timepoints (initial, cycle 6, cycle 12) to track how allele frequencies change over time, potentially revealing selection pressures related to YMR193C-A

    • Maintain large population sizes during crossing to prevent bottlenecks that could limit genetic diversity

  • What are the challenges in interpreting genomic data for putative proteins like YMR193C-A?

    Several significant challenges exist when interpreting genomic data for dubious ORFs:

    • Distinguishing between biological effects and technical artifacts when working with sequences predicted to be non-functional

    • Determining whether phenotypic effects in deletion studies might be due to disruption of overlapping functional elements rather than the dubious ORF itself

    • Accounting for how genetic background significantly influences phenotypic expression, necessitating studies across diverse backgrounds

    • Determining if transcription represents functional mRNA or merely genomic noise

    • Interpreting sequence conservation across strains or species, which might indicate functional constraint or result from other selective pressures

    • Evaluating the potential for the sequence to encode regulatory RNA rather than protein

    • Distinguishing effects of nearby regulatory elements from direct functions of the dubious ORF

  • How do sporulation efficiencies differ in strains with and without YMR193C-A modifications?

    While specific data comparing YMR193C-A mutants isn't available in the search results, methodologies for assessing sporulation efficiency are well-documented:

    • Culture strains in minimal sporulation media (1% potassium acetate) for approximately 72 hours at 30°C with shaking at 200 rpm

    • Quantify sporulation efficiency by counting approximately 200 cells under 40x magnification and calculating the proportion of tetrads relative to total cells

    • Average multiple biological replicates (2-3) to obtain reliable estimates

    • Perform assessments on populations at different stages (e.g., cycle 0 and cycle 12) to track changes over time

    • Examine not just the percentage of cells that form tetrads, but also the viability of resulting spores through tetrad dissection and germination assays

    This methodological framework would reveal any role YMR193C-A might play in meiosis or sporulation processes.

Experimental Design Questions

  • What genome sequencing protocols are recommended for tracking YMR193C-A in recombinant populations?

    Based on the synthetic recombinant population research, recommended protocols include:

    • Extract genomic DNA using established methods like the Qiagen Puregene Yeast/Bact. Kit after growth of single colonies in liquid media

    • Prepare libraries using the Nextera DNA Sample Preparation Kit with modifications to optimize throughput

    • Add recombinant populations to sequencing libraries at 10X the molarity of haploid founder samples to achieve higher coverage for accurate allele frequency estimation

    • Sequence at multiple timepoints to track changes in YMR193C-A frequency over time

    • Use platforms providing longer reads or higher accuracy, such as HiSeq3000 with SE150 reads

    • Implement robust bioinformatic pipelines for allele frequency estimation and haplotype reconstruction

    • Sequence individual clones from the population at different timepoints to capture linkage information and haplotype structures

    This comprehensive approach enables tracking of YMR193C-A variants in complex genetic backgrounds over time.

  • How can high-throughput phenotypic screens be designed to detect subtle effects of dubious ORFs like YMR193C-A?

    Effective high-throughput phenotypic screening approaches include:

    • Utilize drug-hypersensitive genetic backgrounds to amplify subtle phenotypic effects

    • Implement high-resolution morphological analysis using automated microscopy to detect subtle cellular phenotypes

    • Conduct growth rate assays in multiple conditions using plate reader-based approaches with technical and biological replicates

    Assay ParameterSpecificationReference
    Measurement intervalEvery 30 minutes
    Assay duration48 hours at 30°C
    Analysis software"Growthcurver" package
    Biological replicates2-3
    Technical replicates2 per biological replicate
    • Systematically vary stress conditions (temperature, pH, carbon source, osmotic stress, oxidative stress)

    • Apply chemical genomic approaches using diverse small molecule perturbagens

    • Create double mutants through crosses with strains carrying deletions in known pathways

    • Compare growth parameters (doubling time, carrying capacity) across multiple conditions to reveal subtle but significant differences

  • What control strategies are necessary when conducting deletion studies involving YMR193C-A?

    Robust control strategies for deletion studies of dubious ORFs include:

    • Include multiple wild-type control strains with the same genetic background, similar to the 749 replicated wild-type controls in the SCMD database

    • Implement complementation controls involving reintroduction of YMR193C-A at its native locus or at a neutral site

    • Create neighboring gene controls that preserve YMR193C-A but delete adjacent sequences

    • Use different selectable markers for the deletion to ensure phenotypes aren't due to the marker itself

    • Generate independent deletion strains as biological replicates to ensure reproducibility

    • Include technical replicates within assays to control for measurement variation

    • Use positive control strains with deletions in genes known to affect the studied process

    • Conduct assays across multiple conditions, as the function might only be revealed under specific environmental circumstances

  • What growth analysis techniques provide the most sensitivity for detecting YMR193C-A-related phenotypes?

    The most sensitive growth analysis techniques include:

    • Continuous growth monitoring in microplate readers with measurements every 30 minutes for 48 hours at 30°C

    • Analysis using specialized software like "Growthcurver" to extract multiple growth parameters beyond simple endpoints

    • Competition assays between deletion strains and wild-type strains to detect subtle fitness differences

    • Stress response profiling across multiple conditions to identify condition-specific phenotypes

    • Fitness measurements during serial transfers to detect cumulative effects over multiple generations

    • Growth rate analysis in nutrient-limited chemostats to reveal phenotypes under specific limiting conditions

    • High-density growth arrays with image analysis for increased throughput and statistical power

    These methods collectively provide a comprehensive assessment of potential growth phenotypes associated with YMR193C-A.

Data Analysis Questions

  • How should researchers address contradictory findings about the function of YMR193C-A?

    When facing contradictory findings, researchers should:

    • Evaluate genetic background effects, as genetic context significantly influences phenotypic expression

    • Apply pairwise crossing methods to systematically test YMR193C-A effects across diverse genetic backgrounds

    • Rigorously compare methodological differences between studies, including growth conditions and phenotypic assay parameters

    • Assess if contradictions might result from differential effects on overlapping genomic elements

    • Validate using multiple approaches—combining deletion studies, overexpression analysis, and specific functional assays

    • Design experiments that directly test competing hypotheses with carefully controlled variables

    • Conduct meta-analysis of multiple studies, including unpublished negative results

    • Implement collaborative cross-laboratory studies using standardized protocols

    • Consider if contradictions themselves reveal condition-specific functions or complex genetic interactions

  • What statistical approaches are most appropriate for analyzing variable phenotypes potentially linked to YMR193C-A?

    Appropriate statistical approaches include:

    • Mixed-effects models to account for both fixed effects (presence/absence of YMR193C-A) and random effects (genetic background variation)

    • Time-series analysis for growth curve data collected using absorbance-based assays

    • Multivariate analyses (PCA, PLS-DA) for morphological data to identify patterns across multiple parameters simultaneously

    • Bayesian approaches to incorporate prior knowledge about the likelihood of functionality

    • Permutation tests to create empirical null distributions for assessing significance

    • Bootstrapping methods to provide robust confidence intervals for phenotypic measurements

    • Multiple hypothesis correction using methods like Benjamini-Hochberg when testing many phenotypes

    • Network-based statistical approaches for genetic interaction data

    • Meta-analytic approaches to combine results across multiple experiments, providing increased power to detect subtle effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.