Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YMR254C (YMR254C)

Shipped with Ice Packs
In Stock

Description

Introduction to YMR254C

YMR254C is classified as a putative uncharacterized protein that is conserved across S. cerevisiae strains . According to genomic annotations, it is considered a "dubious open reading frame" that is unlikely to encode a functional protein based on available experimental and comparative sequence data . Despite this classification, the protein has been the subject of recombinant production for research purposes, suggesting potential scientific interest in its characteristics and functions.

Basic Properties

YMR254C is a relatively small protein consisting of 102 amino acids . The protein's basic molecular characteristics are summarized in Table 1.

Table 1: Basic Properties of YMR254C Protein

PropertyValue
Systematic NameYMR254C
Alternative NamesYM9920.08C
Length102 amino acids
ClassificationPutative uncharacterized protein
ConservationConserved across S. cerevisiae strains
Gene LocationChromosome XIII
StatusDubious open reading frame

Predicted Functions

Despite being classified as a putative uncharacterized protein, efforts have been made to infer potential functions of YMR254C through various genomic and proteomic approaches. The protein has been included in comprehensive studies aimed at characterizing genes required for protein folding in the endoplasmic reticulum . This suggests a possible association with ER-related processes, although direct experimental evidence for such a role is limited.

Notably, YMR254C has been found to have potential interactions with the transcription factors MET32 and MET4, according to chromatin immunoprecipitation-chip evidence . This suggests a possible role in gene regulation, potentially connected to sulfur metabolism pathways, which are regulated by these transcription factors.

Gene Expression and Regulation

The expression pattern of YMR254C across different conditions and growth phases remains poorly documented. According to the GEMMER database, information regarding the cell cycle phase and timing of peak transcription for YMR254C is not available . Similarly, localization data from GFP studies and CYCLoPs analyses are not documented, further highlighting the limited characterization of this protein .

Recombinant Expression Systems

Several systems have been employed for the recombinant expression of YMR254C, primarily for research purposes. According to commercial sources, the protein has been expressed in various host systems, including:

Table 2: Expression Systems for Recombinant YMR254C

Host SystemProduct FormPurityReference
E. coliRecombinant protein≥85% (SDS-PAGE)
YeastRecombinant protein≥85% (SDS-PAGE)
BaculovirusRecombinant protein≥85% (SDS-PAGE)
Mammalian CellRecombinant protein≥85% (SDS-PAGE)
Cell-Free ExpressionRecombinant protein≥85% (SDS-PAGE)

These expression systems allow for the production of YMR254C for various research applications, including structural studies, functional assays, and antibody production.

Purification Methods

The recombinant YMR254C protein is typically purified to a high degree (≥85% purity) as determined by SDS-PAGE analysis . While specific purification protocols are not detailed in the available literature, standard methods for recombinant protein purification likely involve affinity chromatography, possibly utilizing tags incorporated during the expression process. The purified protein is typically stored in Tris-based buffer with 50% glycerol for stability .

As a Model for Uncharacterized Proteins

YMR254C serves as an example of the challenges and approaches in studying uncharacterized proteins in model organisms. S. cerevisiae has been extensively used as a model organism for studying various biological processes, with significant relevance to human biology . The study of uncharacterized proteins like YMR254C contributes to our understanding of eukaryotic genomics and proteomics.

In Functional Genomics Studies

The YMR254C gene has been included in comprehensive genomic studies, such as the TRIPLES database (TRansposon-Insertion Phenotypes, Localization and Expression in Saccharomyces), which catalogs defined mutant alleles for the analysis of disruption phenotypes, protein localization, and gene expression in S. cerevisiae . Such studies contribute to the broader understanding of gene function in yeast.

Conservation Across Yeast Strains

While YMR254C is described as conserved across S. cerevisiae strains , detailed comparative genomic analyses across different yeast species and strains provide varying perspectives on its conservation and potential functionality. According to the INDYdb database, the gene is classified as a "dubious open reading frame" that is unlikely to encode a functional protein based on available experimental and comparative sequence data .

Examination of the gene across different S. cerevisiae strains reveals variability in annotation status:

Table 4: YMR254C Status Across Different S. cerevisiae Strains

StrainAssemblyApplicationStatusCopy NumberValid ORFReference
AKU4011GCA_001738255.1SakeUnannotated1False
BG1GCA_001932575.1BioethanolVerified1True
BruggemanGCA_001738585.1BreadVerified1True
CAT1GCA_001738705.1BioethanolVerified1True
CBS1585GCA_001738375.1SakeUnannotated1False

This variability in annotation status across strains suggests that the functional significance of YMR254C may depend on the specific genetic background and environmental context of the yeast strain.

Potential Homologs

Efforts to identify homologs of YMR254C in other organisms have been hampered by its classification as a dubious ORF. According to available data, specific homologs in other species have not been well-documented . This lack of clear evolutionary conservation further complicates the functional characterization of the protein.

Potential Involvement in Cellular Processes

While direct experimental evidence for the involvement of YMR254C in specific cellular processes is limited, its inclusion in comprehensive studies of the yeast genome suggests potential roles in various cellular functions. For instance, its potential association with transcription factors involved in sulfur metabolism (MET32 and MET4) hints at a possible role in related metabolic pathways .

Additionally, the protein's hydrophobic nature and potential membrane association suggest it might play a role in membrane-related processes, although this remains speculative without further experimental evidence.

Future Research Directions

Despite the classification of YMR254C as a dubious ORF, several research directions could potentially provide greater insight into its biological significance:

  1. Detailed structural characterization: Advanced structural biology techniques could help determine if the protein adopts a stable three-dimensional structure, which would support its functional relevance.

  2. High-resolution localization studies: Determining the subcellular localization of YMR254C could provide clues about its potential function.

  3. Transcriptomic and proteomic profiling: Analyzing changes in global gene expression and protein abundance in response to YMR254C manipulation could reveal associated pathways.

  4. Comparative genomics across diverse yeast species: Broader evolutionary analysis might identify functional constraints that point to biological significance.

  5. CRISPR-based functional genomics: Systematic gene editing approaches could help identify genetic interactions and functional relationships involving YMR254C.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For multiple uses, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YMR254C; YM9920.08C; Uncharacterized protein YMR254C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YMR254C
Target Protein Sequence
MVPLILLILLFSKFSTFLRPVNHVLVTKYTAIVNTKWQTTPSIIDVTYTMHVFYMTIILI LVRKQMQSIHAFLGSLCLPSHVLDFSIVRDILSWYFLETVAV
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the current state of knowledge about YMR254C?

YMR254C is a putative uncharacterized protein in Saccharomyces cerevisiae (baker's yeast) that remains largely unstudied. Current research suggests it may be involved in cellular processes, but its specific function, structure, and interactions remain to be fully elucidated. As an uncharacterized protein, YMR254C represents an opportunity for novel discoveries in yeast molecular biology. Researchers typically begin investigation with sequence analysis, homology studies, and preliminary expression analysis before moving to more advanced functional characterization techniques .

What expression systems are suitable for recombinant production of YMR254C?

For recombinant production of YMR254C, several expression systems can be employed:

Expression SystemAdvantagesLimitationsYield Potential
Native S. cerevisiaeNative post-translational modifications, proper foldingLower yields than bacterial systemsModerate
E. coliHigh yields, rapid growth, simple mediaLacks eukaryotic post-translational modificationsHigh
Pichia pastorisEukaryotic system, high-density cultivationMore complex than E. coliHigh
Insect cellsAdvanced eukaryotic modificationsComplex, expensiveModerate

Selection should be based on research objectives, particularly whether native modifications are essential for functional studies. S. cerevisiae remains advantageous as both host and source organism, potentially offering correct folding and processing of the native protein .

How can I verify successful expression of recombinant YMR254C?

Verification of successful YMR254C expression requires multiple complementary techniques:

  • Western blotting with anti-tag antibodies (if using tagged constructs) or custom anti-YMR254C antibodies

  • SDS-PAGE analysis showing a band of expected molecular weight

  • Mass spectrometry for protein identification confirmation

  • RT-PCR to confirm transcription of the gene

  • Fluorescence microscopy if using GFP or other fluorescent tags

For quantitative assessment, combine densitometry analysis of Western blots with total protein quantification methods such as Bradford assay or BCA assay .

What are the optimal experimental design approaches for studying YMR254C function?

When investigating the function of YMR254C, a systematic experimental design is crucial. Begin by clearly defining your variables:

Independent variables: Potential factors include YMR254C expression levels, growth conditions, genetic background, and environmental stressors.

Dependent variables: Observable outcomes may include growth rates, metabolic profiles, protein-protein interactions, or cellular phenotypes.

A robust experimental design should include:

  • Gene deletion studies comparing wild-type and ΔYMR254C strains under various conditions

  • Complementation experiments to confirm phenotypes result from YMR254C loss

  • Protein localization studies using fluorescent tags

  • Controlled expression using inducible promoters

  • Interactome studies using techniques like yeast two-hybrid or co-immunoprecipitation

For statistical validity, ensure adequate biological replicates (n≥3) and technical replicates (n≥3) for each experimental condition .

How can I design experiments to determine YMR254C cellular localization?

Determining the cellular localization of YMR254C requires careful experimental design that maintains protein functionality while enabling visualization:

  • GFP fusion constructs: Create C-terminal and N-terminal GFP fusions to determine which maintains functionality

  • Verification approach:

TechniquePurposeControls
Live-cell imagingDirect visualizationOrganelle markers
Subcellular fractionationBiochemical confirmationOrganelle-specific proteins
ImmunolocalizationAntibody detectionKnown localization proteins
Proximity labelingNearby protein identificationNon-specific biotinylation

It's essential to validate localization findings using multiple independent methods, as protein overexpression or tagging can sometimes lead to mislocalization artifacts. Additionally, observe localization under various growth conditions, as some proteins relocalize in response to environmental stimuli .

What control experiments are necessary when generating YMR254C knockout strains?

When generating YMR254C knockout strains, several critical control experiments must be performed:

  • Verification of gene deletion: Confirm complete deletion using PCR with primers outside the deletion cassette

  • Complementation: Reintroduce YMR254C on a plasmid to verify phenotypes are specifically due to YMR254C deletion

  • Off-target effects: Sequence genome regions near deletion site to confirm no unintended mutations

  • Growth comparison: Document growth curves under standard and stress conditions

  • Phenotypic stability: Verify consistency of phenotypes across multiple passages

Additionally, include isogenic wild-type strains and, if available, strains with deletions in genes of related function as experimental controls. For rigorous analysis, perform transcriptomic or proteomic profiling to identify any compensatory changes in gene expression that might mask phenotypic effects .

What are the appropriate methods for purifying recombinant YMR254C?

Purification of recombinant YMR254C requires optimization based on its biophysical properties. The following methods can be employed:

  • Affinity chromatography: If using His-tagged constructs, nickel or cobalt resins provide efficient initial purification

  • Ion exchange chromatography: Based on predicted isoelectric point (pI) of YMR254C

  • Size exclusion chromatography: For final polishing and determination of oligomeric state

  • Gradient optimization:

StepBuffer CompositionPurposeConsiderations
Cell lysis50mM Tris-HCl pH 8.0, 150mM NaCl, 1mM DTT, protease inhibitorsExtract proteinOptimize detergent if membrane-associated
Affinity bindingAbove + 10mM imidazoleReduce non-specific bindingAdjust imidazole based on binding strength
WashingAbove + 20-50mM imidazoleRemove contaminantsDetermine optimal concentration empirically
ElutionAbove + 250-500mM imidazoleRelease target proteinStep or gradient elution

Purification should be performed at 4°C to minimize degradation, and stability tests should determine optimal storage conditions. If the protein proves difficult to solubilize, consider using S. cerevisiae ghost preparations as described by Amara, which maintain the native membrane environment while allowing protein extraction .

What approaches are most effective for studying protein-protein interactions involving YMR254C?

To comprehensively characterize protein-protein interactions involving YMR254C, employ complementary methodologies:

  • Yeast two-hybrid screening: Useful for initial identification of potential interactors

  • Co-immunoprecipitation: Confirms interactions in near-native conditions

  • Proximity-based labeling (BioID, APEX): Identifies spatial proximity in living cells

  • Surface plasmon resonance: Determines binding kinetics and affinity constants

  • Cross-linking mass spectrometry: Maps interaction interfaces

  • Interaction validation matrix:

MethodStrengthsLimitationsFalse Positive Control
Yeast two-hybridHigh-throughput, in vivoProne to false positivesEmpty vector, unrelated bait
Co-IPNear-native conditionsMay lose transient interactionsNon-specific IgG, reverse Co-IP
BioIDCaptures weak/transient interactionsBiotinylation radius (~10nm)BirA* alone expression
SPRQuantitative kineticsRequires purified proteinsNegative control protein

When analyzing results, prioritize interactions detected by multiple independent methods and consider the biological context of potential interactors, such as co-expression patterns, subcellular localization, and functional annotation .

How should I approach transcriptomic analysis of YMR254C deletion strains?

Transcriptomic analysis of YMR254C deletion strains requires careful experimental design and rigorous data analysis:

  • Experimental design considerations:

    • Compare ΔYMR254C to isogenic wild-type strain

    • Include biological replicates (n≥3)

    • Consider multiple growth conditions that might reveal condition-specific functions

    • Include time-course analysis if temporal changes are suspected

  • RNA extraction protocol optimization:

    • Standardize cell harvesting at precise growth phase

    • Confirm RNA integrity (RIN >8) before proceeding

    • Include spike-in controls for normalization

  • Analysis workflow:

StageMethodQuality Control
Library preparationRNA-Seq, stranded librariesFragment size distribution
SequencingIllumina platform, >20M reads/sampleQ30 score >80%
AlignmentHISAT2 to S. cerevisiae genomeMapping rate >90%
QuantificationHTSeq-count or featureCountsGene body coverage
Differential expressionDESeq2 or edgeRMA plots, PCA clustering
Pathway analysisGO term enrichment, KEGGMultiple testing correction
  • Validation: Confirm key differentially expressed genes using RT-qPCR with appropriate reference genes that show stability in your experimental conditions.

Interpretation should consider both direct and indirect effects, as transcriptional changes may represent compensatory responses rather than direct regulation by YMR254C .

How can I integrate multi-omics data to better understand YMR254C function?

Integrating multi-omics data provides a comprehensive understanding of YMR254C function by capturing different aspects of cellular biology:

  • Data generation strategy:

    • Transcriptomics: RNA-Seq of wild-type vs. ΔYMR254C strains

    • Proteomics: Quantitative MS analysis of protein abundance changes

    • Metabolomics: LC-MS profiling of metabolic changes

    • Interactomics: AP-MS or BioID to identify protein interactions

  • Integration approaches:

Integration MethodApplicationAdvantagesTools
Network analysisIdentify functional modulesReveals indirect connectionsCytoscape, STRING
Multi-omics factor analysisIdentify latent factorsReduces dimensionalityMOFA, mixOmics
Pathway enrichmentIdentify affected processesBiological contextPathVisio, GSEA
Causal reasoningInfer regulatory relationshipsMechanistic insightsIngenuity, CARNIVAL
  • Validation strategy: Hypotheses generated through multi-omics integration should be experimentally validated through targeted gene deletions, protein-protein interaction studies, or metabolic flux analysis depending on the specific predictions.

The integration process should acknowledge different noise levels and temporal dynamics across data types. For example, transcriptomic changes may precede proteomic changes, which in turn may precede metabolic adjustments .

What strategies can address challenges in structural characterization of YMR254C?

Structural characterization of YMR254C likely presents challenges due to its uncharacterized nature. Multiple complementary approaches can overcome these challenges:

  • Computational prediction:

    • Homology modeling if detectable structural homologs exist

    • Ab initio modeling for novel folds

    • AlphaFold2 or RoseTTAFold for AI-assisted prediction

  • Experimental structure determination:

MethodResolutionSample RequirementsChallenges for YMR254C
X-ray crystallographyPotentially atomicMilligram quantities, crystalsCrystallization may be difficult
Cryo-EMNear-atomicMicrogram quantitiesSize may be too small (<50kDa)
NMR spectroscopyAtomicMilligram quantities, solubleSize limitations, stability concerns
HDX-MSRegional dynamicsMicrogram quantitiesLower resolution but fewer constraints
  • Hybrid approaches: Integrate low-resolution experimental data (SAXS, XL-MS) with computational models to refine structural predictions.

  • Functional validation: Perform site-directed mutagenesis of predicted functional residues based on structural models to validate their importance.

If traditional approaches prove challenging, consider studies of YMR254C within the native membrane environment using S. cerevisiae ghost preparations, which maintain the 3D structure of cellular components while allowing access for structural probes .

How can contradictory data about YMR254C function be reconciled?

When faced with contradictory data regarding YMR254C function, a systematic reconciliation approach is essential:

  • Methodological differences assessment:

    • Compare experimental conditions (media, temperature, growth phase)

    • Evaluate strain background differences (laboratory vs. wild strains)

    • Consider tag position effects (N-terminal vs. C-terminal)

    • Assess expression levels (native vs. overexpression)

  • Multifaceted protein function:

    • YMR254C may have context-dependent functions

    • Different domains may mediate distinct activities

    • Post-translational modifications may alter function

  • Reconciliation framework:

Contradiction TypeInvestigation ApproachExpected Outcome
Localization discrepanciesTime-course imaging under multiple conditionsIdentification of dynamic relocalization triggers
Phenotypic differencesEpistasis analysis with related genesPlacement in genetic pathway
Interaction partner conflictsIn vitro validation of direct bindingDistinction between direct and indirect interactions
Expression effect variationsDose-response experimentsThreshold identification for phenotypic effects
  • Meta-analysis technique: Implement a formalized approach to evaluating evidence quality, such as assigning confidence scores based on methodology rigor, reproducibility, and validation approaches.

Remember that biological contradictions often reveal new insights—YMR254C may have multiple functions depending on cellular context, post-translational modification state, or interaction partners .

What are the future research directions for YMR254C?

Based on current understanding and methodological approaches, several promising research directions for YMR254C emerge:

  • Comprehensive functional characterization:

    • Conduct phenomics analysis across diverse environmental conditions

    • Perform synthetic genetic array analysis to identify genetic interactions

    • Develop conditional alleles to study essential functions

  • Regulatory network mapping:

    • Identify transcriptional regulators controlling YMR254C expression

    • Characterize post-translational modifications and their functional impact

    • Map the complete interactome under various cellular conditions

  • Evolutionary significance:

    • Compare function across fungal species to understand conservation

    • Identify potential paralogs within S. cerevisiae

    • Investigate potential horizontal gene transfer events

  • Translational applications:

    • Explore biotechnological applications if unique enzymatic activities are discovered

    • Assess as a potential antifungal target if essential for pathogenic fungi

The field would benefit from establishing a standardized set of assays and growth conditions to facilitate cross-laboratory comparisons. Additionally, developing specific antibodies against YMR254C would enable more precise native protein studies without tag-related artifacts .

How can researchers contribute to the collective knowledge about YMR254C?

To advance collective knowledge about YMR254C, researchers should adopt practices that enhance reproducibility, data sharing, and collaborative investigation:

  • Standardized protocols:

    • Document detailed methods, including strain backgrounds, media compositions, and growth conditions

    • Report negative results to prevent duplication of unsuccessful approaches

    • Use consistent nomenclature and identifiers

  • Data sharing:

    • Deposit raw data in appropriate repositories (e.g., Gene Expression Omnibus, ProteomeXchange)

    • Share plasmids and strains through repositories like Addgene and ATCC

    • Contribute annotations to SGD (Saccharomyces Genome Database)

  • Community engagement:

    • Establish a YMR254C working group or interest community

    • Develop shared research priorities and coordinate complementary approaches

    • Consider targeted collaborative funding applications

  • Knowledge synthesis:

    • Periodically conduct systematic reviews of available evidence

    • Develop consensus models of function that incorporate diverse findings

    • Identify key knowledge gaps for targeted investigation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.