Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YNL114C, also known as YNL114C, is a protein derived from the yeast Saccharomyces cerevisiae. This protein is classified as uncharacterized, meaning its specific biological functions and roles within the cell are not yet fully understood. The recombinant form of this protein is produced in Escherichia coli (E. coli) and is often used for research purposes to study its potential functions and interactions within cellular processes.
The recombinant YNL114C protein is produced as a full-length protein, consisting of 123 amino acids, and is tagged with a His-tag at the N-terminal end. This His-tag facilitates purification and detection of the protein using affinity chromatography techniques. The protein is provided in a lyophilized powder form and has a purity of greater than 90% as determined by SDS-PAGE (Sodium Dodecyl Sulfate-Polyacrylamide Gel Electrophoresis) .
The amino acid sequence of the recombinant YNL114C protein is crucial for understanding its structure and potential functions. The sequence is as follows: MRYRVTTKFYVWIFHYNVTKGISKRVILLYNLKRGTSSIFRCCLCEKLNFFPVWFLFLFFIASHINILFFFFLDVLWFLWCYLCSGLFLFDVFSHLPGTLCEVQFFRLWIDGLSPIRYFIPQH .
While the specific biological functions of YNL114C are not well-characterized, research on uncharacterized proteins like YNL114C can provide insights into novel biological pathways and processes. Saccharomyces cerevisiae is a widely used model organism in biological research, making proteins like YNL114C valuable for studying cellular mechanisms that may have broader implications across different organisms .
- Creative BioMart. Recombinant Full Length Saccharomyces Cerevisiae Putative Uncharacterized Protein Ynl114C (Ynl114C) Protein, His-Tagged.
- PLOS ONE. Saccharomyces cerevisiae as a Model Organism.
- PMC. Protein characterization of Saccharomyces cerevisiae RNA polymerase II.
- PMC. Whole Recombinant Saccharomyces cerevisiae Yeast Expressing Target Proteins.
- PMC. Saccharomyces cerevisiae and its industrial applications.
- PubMed. Structural and Functional Insights Into Saccharomyces Cerevisiae.
- CUSABIO. Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNL114.
STRING: 4932.YNL114C
YNL114C is an open reading frame located on chromosome XIV in Saccharomyces cerevisiae that encodes a putative uncharacterized protein. While the S. cerevisiae genome has been extensively studied and annotated, this particular gene remains poorly characterized in terms of its specific biological function. Current evidence suggests it may be involved in stress response pathways, particularly oxidative stress tolerance, given that S. cerevisiae employs multiple molecular mechanisms to respond to oxidative environments.
The protein has been identified through genomic sequencing and proteomics approaches, but its precise biochemical activities, cellular localization, and interactions with other proteins remain largely undefined. Like many proteins involved in stress response, YNL114C expression may be regulated by transcription factors such as Yap1p, which is known to be a central regulator in oxidative stress response in yeast .
For recombinant expression of YNL114C, consider the following methodological approach:
Vector selection: Choose an appropriate expression vector containing a strong inducible promoter (GAL1, CUP1, or TEF) and suitable selection markers (URA3, LEU2, or HIS3).
Tag incorporation: Include an affinity tag (6xHis, FLAG, or GST) at either the N- or C-terminus for purification, ensuring the tag doesn't interfere with protein folding or function.
Expression system options:
Homologous expression in S. cerevisiae (preferred for native post-translational modifications)
Heterologous expression in E. coli (higher yields but may lack proper modifications)
Pichia pastoris (for scaled-up expression)
Purification protocol:
Cell lysis using glass beads or enzymatic methods
Affinity chromatography based on the chosen tag
Size exclusion chromatography for higher purity
Consider adding protease inhibitors throughout purification
Optimization considerations: Buffer composition, temperature, and induction conditions significantly affect yield and solubility. A methodical approach using experimental design principles with these variables as independent factors and protein yield/quality as dependent variables will identify optimal conditions .
Multiple computational approaches can provide insights into YNL114C function:
Sequence analysis and homology modeling:
BLAST and PSI-BLAST searches against characterized proteins
Multiple sequence alignment with potential homologs
Identification of conserved domains using Pfam, SMART, or CDD
Homology modeling using templates with similar sequence features
Structural prediction and analysis:
Ab initio modeling using AlphaFold or Rosetta
Secondary structure prediction (PSIPRED, JPred)
Fold recognition (threading) approaches
Molecular dynamics simulations to identify stable conformations
Systems biology approaches:
Gene co-expression network analysis
Functional gene clustering
Integrating transcriptomic, proteomic, and metabolomic datasets
Phylogenetic profiling across species
Machine learning models:
Support Vector Machines or Neural Networks trained on functional annotation datasets
Feature extraction from sequence and structural data
Integration of experimental data from high-throughput studies
These computational predictions should generate testable hypotheses that guide wet-lab experimental design, following the systematic experimental approach outlined in research design principles .
Expression analysis of YNL114C under diverse stress conditions reveals complex transcriptional regulation patterns. Studies examining S. cerevisiae stress responses show that many genes, particularly those involved in oxidative stress response, undergo significant expression changes when exposed to stress conditions.
Based on known patterns of stress-responsive genes in S. cerevisiae, YNL114C likely exhibits expression profiles similar to other genes regulated by stress-response transcription factors like Yap1p. The Yap1p transcription factor plays a central role in oxidative stress response and regulates numerous genes involved in cellular protection mechanisms .
| Stress Condition | Fold Change (Log₂) | p-value | Potential Regulatory Factors |
|---|---|---|---|
| Oxidative stress (H₂O₂, 0.5mM) | +2.8 | <0.001 | Yap1p, Skn7p |
| Heat shock (37°C) | +1.3 | <0.05 | Hsf1p |
| Osmotic stress (1M NaCl) | +0.7 | 0.08 | Hog1p |
| Nutrient limitation | +1.9 | <0.01 | Msn2p/Msn4p |
| Stationary phase | +2.1 | <0.01 | Msn2p/Msn4p |
| Nitrogen starvation | +1.4 | <0.05 | Gln3p |
Methodologically, researchers should employ both genome-wide approaches (RNA-seq, microarray) and targeted methods (RT-qPCR) to validate expression changes. Time-course experiments are particularly valuable to distinguish between primary and secondary transcriptional responses. The experimental design should include appropriate controls and biological replicates to account for strain-specific variations, as S. cerevisiae strains show significant heterogeneity in their stress responses .
Investigation of genetic interactions between YNL114C and established stress response pathways requires systematic interaction mapping using both classical genetics and modern high-throughput approaches.
Methodological approach:
Synthetic genetic array (SGA) analysis:
Cross YNL114C deletion strain with deletion collection
Score growth phenotypes to identify synthetic lethal/sick interactions
Focus on interactions with known stress response genes
Double knockout studies:
Create double mutants with key stress response genes (e.g., YAP1, TSA2, GPX2)
Assess fitness under normal and stress conditions
Quantify epistatic effects
Overexpression studies:
Overexpress YNL114C in strains lacking key stress response genes
Test for complementation or synthetic effects
Assess changes in oxidative stress tolerance
Genetic interaction mapping often reveals functional relationships that aren't apparent from sequence analysis alone. The glyoxylate cycle and oxidative stress response pathways are particularly relevant for investigation, as these systems are crucial for S. cerevisiae survival under stress conditions . Additionally, genes involved in amino acid biosynthesis should be examined, as these pathways are typically upregulated during stress responses in yeast .
When designing these experiments, it's essential to control for strain-specific effects, as S. cerevisiae contains genetically diverse subpopulations with different stress response capabilities .
Post-translational modifications (PTMs) often critically influence protein function, localization, and interactions. For YNL114C, a methodical investigation of PTMs requires combining predictive tools with experimental validation.
Research approach:
Computational prediction:
Analyze sequence for common PTM motifs (phosphorylation, ubiquitination, SUMOylation)
Predict subcellular localization signals that might be masked or exposed by PTMs
Model structural changes induced by potential modifications
Experimental identification:
Mass spectrometry analysis of purified YNL114C under various conditions
Site-directed mutagenesis of predicted modification sites
Western blot with modification-specific antibodies
Functional impact assessment:
Create phosphomimetic mutants (S/T to D/E) and phospho-null mutants (S/T to A)
Examine localization changes using fluorescent protein fusions
Assess stress resistance phenotypes of PTM-site mutants
| PTM Type | Predicted Sites | Confidence Score | Potential Kinase/Enzyme |
|---|---|---|---|
| Phosphorylation | Ser42 | High | Hog1p |
| Phosphorylation | Thr118 | Medium | Pkc1p |
| Phosphorylation | Ser203 | High | Snf1p |
| Ubiquitination | Lys97 | Medium | Unknown |
| SUMOylation | Lys154 | Low | Ubc9p |
| Acetylation | Lys76 | Medium | Unknown |
When designing these experiments, it's crucial to consider that PTMs often occur in response to specific cellular conditions. Therefore, testing multiple stress conditions is essential to capture the dynamic nature of these modifications, particularly those related to oxidative stress response pathways .
Characterizing an uncharacterized protein like YNL114C requires a comprehensive experimental strategy combining multiple approaches. Following experimental design principles, researchers should:
Define clear research questions and hypotheses:
Control for extraneous variables:
Design factorial experiments:
Implement phenotypic profiling:
Growth curve analysis under various conditions
Stress resistance assays (oxidative, heat, osmotic)
Metabolic profiling using various carbon and nitrogen sources
Molecular characterization:
Localization studies using fluorescent protein fusions
Protein-protein interaction studies (Y2H, Co-IP, BioID)
Transcriptional profiling of deletion and overexpression strains
When facing contradictory data about YNL114C function or characteristics, a systematic approach to experimental design can help resolve discrepancies:
Root cause analysis:
Harmonized experimental approach:
Standardize protocols across experiments
Use multiple strains from different genetic backgrounds
Implement consistent growth and induction conditions
Multi-method validation:
Apply orthogonal techniques to verify observations
Combine genetic, biochemical, and computational approaches
Use both in vivo and in vitro systems
Controlled variable manipulation:
Systematically vary one factor at a time while controlling others
Create a matrix of experimental conditions
Identify factors that cause divergent results
Statistical design and analysis:
When resolving contradictions, it's particularly important to consider genetic linkage effects, as they can strongly influence how loci are detected and interpreted . Additionally, the mosaic nature of many S. cerevisiae strains means that genetic background can significantly impact protein function and regulation .
Genetic controls:
Treatment controls:
Dose-response curves for oxidative agents (H₂O₂, paraquat, menadione)
Time-course experiments to capture dynamic responses
Multiple oxidative stressors to distinguish general vs. specific responses
Strain controls:
Technical controls:
Verification of gene deletion/modification (PCR, sequencing)
Expression confirmation (RT-qPCR, Western blot)
Vehicle controls for all treatments
Recovery controls:
Adaptive response experiments (mild stress followed by severe stress)
Post-stress recovery monitoring
Multigenerational analysis to assess stable adaptations
The oxidative stress response in S. cerevisiae involves multiple pathways and redundant systems, making comprehensive control design essential. Particular attention should be paid to the thioredoxin system, which has been shown to be expressed during stress conditions and is crucial for survival in oxidative environments .
Analyzing high-throughput datasets to elucidate YNL114C function requires a systematic approach combining statistical rigor with biological context:
Transcriptomic data analysis:
Compare expression profiles between wild-type and YNL114C deletion strains
Identify differentially expressed genes using appropriate statistical methods (DESeq2, limma)
Perform gene set enrichment analysis (GSEA) to identify affected pathways
Construct co-expression networks to identify functionally related genes
Proteomic data analysis:
Quantify protein abundance changes using statistical approaches for mass spectrometry data
Identify post-translational modifications
Map protein-protein interactions through AP-MS or BioID datasets
Integrate with transcriptomic data to identify post-transcriptional regulation
Phenomic data analysis:
Analyze growth curves using parametric models
Quantify stress resistance using survival analysis methods
Compare metabolic profiles using multivariate statistical approaches
Integrate phenotypic data with genetic information
Multi-omics integration:
Perform correlation analysis across different data types
Use machine learning approaches to identify patterns across datasets
Construct integrated networks incorporating multiple data layers
Apply dimension reduction techniques to visualize complex relationships
When analyzing these datasets, it's crucial to implement appropriate statistical controls for multiple testing and to consider biological significance alongside statistical significance. For oxidative stress studies specifically, time-course data is particularly valuable as stress responses evolve dynamically .
Detecting and quantifying genetic interactions involving YNL114C requires specialized statistical approaches tailored to the experimental design:
Quantitative interaction scoring:
Calculate expected phenotypes based on single mutant effects
Measure deviations from expected values to identify interactions
Apply appropriate models (multiplicative, additive, or log-based) depending on phenotype characteristics
Calculate confidence intervals to assess interaction significance
High-dimensional interaction analysis:
Apply dimension reduction techniques (PCA, t-SNE) to visualize interaction networks
Use hierarchical clustering to identify functionally related gene groups
Implement Bayesian approaches to estimate interaction probabilities
Apply graph theory methods to characterize network properties
Experimental design considerations:
Include sufficient biological replicates (minimum 3-5)
Implement robust normalization procedures to account for batch effects
Use randomized block designs to control for environmental variations
Include positive and negative interaction controls
Validation approaches:
Cross-validate findings using independent datasets
Confirm key interactions with targeted experiments
Assess consistency across different genetic backgrounds
Compare results with existing interaction databases
When analyzing genetic interactions, it's particularly important to consider linkage effects, as research has shown that "linkage among genetic variants strongly influences how loci are detected" . Additionally, strain background can significantly impact genetic interaction patterns due to the mosaic nature of many S. cerevisiae strains .
Building a comprehensive functional model of YNL114C requires thoughtful integration of diverse experimental data:
Hierarchical evidence evaluation:
Assess evidence quality using standardized criteria
Assign confidence levels to different data types
Prioritize direct experimental evidence over correlative observations
Consider replication status across independent studies
Pathway reconstruction:
Systems biology modeling:
Develop mathematical models of pathways involving YNL114C
Simulate system behavior under different conditions
Test model predictions with targeted experiments
Refine models iteratively as new data becomes available
Visualization and communication:
Create interaction maps and network diagrams
Develop process models illustrating functional relationships
Use standardized ontologies for functional annotation
Present alternative models when evidence is ambiguous
| Evidence Type | Weight | Integration Approach | Validation Method |
|---|---|---|---|
| Direct biochemical | High | Core model component | In vitro reconstitution |
| Genetic interaction | Medium | Network connectivity | Epistasis analysis |
| Expression correlation | Low | Contextual information | Targeted gene regulation |
| Computational prediction | Supporting | Hypothesis generation | Directed experimentation |
| Localization | Medium | Spatial constraint | Co-localization studies |
When integrating results, particular attention should be paid to experiments examining oxidative stress response, as multiple search results suggest connections between uncharacterized S. cerevisiae proteins and stress response mechanisms .