Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNL174W (YNL174W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary based on the purchasing method or location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YNL174W; N1669; Putative uncharacterized protein YNL174W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YNL174W
Target Protein Sequence
MALEFLAATRGMDNLVMSCSVTLLFSSSLSFVLAIKNLTKSSFVVSKDKLPIQTPYLFSS FFFFFTTSPDSSPVGVLIVDSSPWASFSEAPDFFFSASSLYSSIDLGSILYFAFNSSRVT LPLLKRRFCFFDRGMELFRSISISSSAFLFFVGSSKAFLTCSSLSFFVTASSFDSSVSDI LSQIIESCWV
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YNL174W and why is it significant to study?

YNL174W is a putative uncharacterized protein in Saccharomyces cerevisiae for which limited functional information exists. Studying uncharacterized proteins like YNL174W is critical because they represent substantial knowledge gaps in our understanding of cellular systems. Similar approaches to those used in E. coli for characterizing unknown transcription factors can be applied, including computational prediction followed by experimental validation . Research on uncharacterized proteins contributes to completing our understanding of yeast genomics, potentially revealing novel cellular mechanisms, regulatory pathways, or therapeutic targets.

What expression systems are most effective for producing recombinant YNL174W protein?

For recombinant expression of YNL174W, homologous expression within S. cerevisiae itself often proves most effective, as it provides the native cellular machinery and post-translational modifications. When expressing the protein, researchers should consider using inducible promoter systems such as GAL1 or CUP1 to control expression levels. Epitope tagging strategies, similar to the myc-tagging approach used for E. coli transcription factors, can facilitate protein detection and purification . For higher yields, optimized growth conditions including appropriate media composition and induction timing should be systematically evaluated through pilot experiments before scaling up production.

How can I confirm the successful expression of recombinant YNL174W?

Successful expression can be verified through multiple complementary techniques. Western blotting using antibodies against either the native protein or an epitope tag represents the standard approach. SDS-PAGE followed by mass spectrometry analysis provides additional confirmation of protein identity and purity. For quantification, techniques such as Bradford or BCA protein assays can determine concentration. If structural studies are planned, circular dichroism can verify proper protein folding. For localization studies, fluorescence microscopy using GFP-fusion constructs helps determine subcellular distribution, potentially providing initial functional clues.

What computational approaches can predict potential functions of YNL174W?

Advanced computational prediction of YNL174W function should employ multiple bioinformatic approaches. Sequence-based predictions using algorithms similar to TFpredict (which was used for bacterial transcription factor prediction) can identify potential DNA-binding domains or transcription factor characteristics . Structural homology modeling using platforms like SWISS-MODEL can generate three-dimensional models based on proteins with similar sequences, providing insights into potential binding sites and molecular interactions . Protein-protein interaction predictions through tools like STRING can place YNL174W in potential functional networks. Additionally, comparative genomics across fungal species can identify evolutionary conservation patterns that suggest functional importance. Integration of these computational predictions creates a framework for targeted experimental validation.

How can ChIP-sequencing be optimized for studying YNL174W's potential DNA interactions?

Optimizing ChIP-sequencing for YNL174W requires careful experimental design. First, expression constructs should incorporate epitope tags (myc, FLAG, or HA) that have well-characterized antibodies with low background in yeast. Crosslinking conditions should be systematically optimized; the 25-minute formaldehyde treatment at 1% concentration used for E. coli studies provides a starting point but may require adjustment for yeast cells with cell walls . Sonication parameters need optimization to generate 300-500bp DNA fragments as used in the E. coli protocol . For immunoprecipitation, magnetic beads coupled with antibodies against the chosen epitope tag should be employed, followed by stringent washing to reduce non-specific binding. Advanced ChIP-exo methodology, which uses exonuclease treatment to improve resolution, can provide more precise binding site identification as demonstrated in the E. coli transcription factor study . Library preparation should include quality control steps at multiple points to ensure robust sequencing results.

What approaches can resolve contradictory data when characterizing YNL174W function?

When faced with contradictory data during YNL174W characterization, a systematic troubleshooting approach is essential. Begin by evaluating the reliability of different experimental techniques; for instance, in vivo results may differ from in vitro observations due to missing cofactors or physiological conditions. Perform independent validation using orthogonal techniques—if ChIP-seq and RNA-seq data conflict, validate with ChIP-qPCR and RT-qPCR on selected targets. Consider conditional functionality by testing under diverse environmental conditions, as protein function may be context-dependent. Statistical analysis using approaches like those employed in differential expression analysis (Wald test with Benjamini-Hochberg correction) can help distinguish significant effects from experimental noise . Meta-analysis combining results from multiple experiments with weighted significance can help resolve contradictions. Finally, collaboration with specialists in relevant techniques can provide valuable insights into potential methodological limitations.

What knockout/knockdown strategies are most effective for studying YNL174W function?

For studying YNL174W function through loss-of-function approaches, several complementary strategies should be considered. CRISPR-Cas9 gene editing offers precise knockout generation with minimal off-target effects, while traditional homologous recombination with selection markers remains reliable in yeast. For conditional studies, placing YNL174W under control of regulatable promoters (tetracycline-responsive or auxin-inducible degron systems) allows titrated expression reduction. RNA interference approaches, though less common in S. cerevisiae, can be employed through expression of short hairpin RNAs. Following genetic manipulation, comprehensive phenotype analysis should include growth rate measurements across diverse conditions, metabolite profiling, and transcriptomic analysis. Complementation studies, reintroducing wild-type or mutant versions of YNL174W, can confirm phenotype specificity. For genome-scale interaction studies, synthetic genetic array technology can identify genetic interactions by combining YNL174W deletion with genome-wide mutation collections.

How should I design experiments to identify potential binding partners of YNL174W?

Identifying YNL174W binding partners requires a multi-faceted experimental approach. Co-immunoprecipitation followed by mass spectrometry represents the foundation of protein interaction studies, requiring careful optimization of buffer conditions to preserve native interactions. For detecting transient interactions, in vivo crosslinking with formaldehyde prior to immunoprecipitation enhances capture efficiency. Yeast two-hybrid screening provides an orthogonal method for identifying binary interactions, though false positives necessitate secondary validation. For higher confidence, proximity-dependent labeling methods like BioID or APEX can identify proteins in close proximity to YNL174W in living cells. Fluorescence techniques including FRET (Förster Resonance Energy Transfer) and BiFC (Bimolecular Fluorescence Complementation) allow visualization of interactions in vivo. Validation of key interactions should include reciprocal co-immunoprecipitation and functional studies demonstrating biological relevance of the interaction.

What structural analysis methods would be most informative for YNL174W characterization?

Structural characterization of YNL174W should employ a hierarchical approach beginning with computational prediction followed by experimental validation. Homology modeling using tools like SWISS-MODEL can generate initial structural predictions based on proteins with similar sequence, as was done for candidate transcription factors in E. coli . For experimental structure determination, X-ray crystallography remains the gold standard if the protein can be successfully crystallized. Nuclear Magnetic Resonance (NMR) spectroscopy provides an alternative for smaller domains and offers the advantage of analyzing dynamics in solution. Cryo-electron microscopy has increasingly become valuable for larger protein complexes. Limited proteolysis coupled with mass spectrometry can identify domain boundaries and structured regions. Hydrogen-deuterium exchange mass spectrometry provides insights into protein dynamics and ligand-binding sites. Circular dichroism spectroscopy offers rapid assessment of secondary structure content. Integration of these approaches creates a comprehensive structural understanding that informs functional hypotheses.

How can transcriptomic data help elucidate YNL174W function?

Transcriptomic analysis provides powerful insights into YNL174W function through multiple analytical approaches. RNA-seq comparing wild-type and YNL174W deletion strains can identify differentially expressed genes using statistical frameworks similar to the Wald test with Benjamini-Hochberg correction for multiple testing as applied in E. coli studies . Expression changes with log2(fold-change) ≥ 2.0 and adjusted P-value < 0.05 represent statistically robust differences . Gene Ontology enrichment analysis of affected genes can reveal biological processes potentially influenced by YNL174W. Time-course transcriptomics following YNL174W induction or repression helps distinguish direct from indirect effects based on temporal patterns. Integration with ChIP-seq data, if YNL174W proves to be a DNA-binding protein, allows correlation between binding events and expression changes. Network analysis using algorithms like WGCNA (Weighted Gene Co-expression Network Analysis) can identify modules of co-regulated genes. Comparison with existing transcriptomic datasets from diverse conditions may reveal conditions where YNL174W function is particularly important.

What systems biology approaches can integrate YNL174W into broader cellular networks?

Systems biology approaches for contextualizing YNL174W function should employ multilayered data integration. Network reconstruction using protein-protein interaction data, genetic interaction screens, and co-expression analysis can position YNL174W within functional modules. Flux balance analysis incorporating YNL174W-related constraints can predict metabolic consequences of its activity. Multi-omics integration combining transcriptomics, proteomics, and metabolomics data from wild-type and YNL174W mutant strains provides a comprehensive view of cellular impact. Machine learning approaches can identify patterns across diverse datasets that might not be apparent through traditional analysis. Perturbation response studies examining how YNL174W deletion alters cellular responses to environmental changes help define its role in adaptation. Mathematical modeling of relevant pathways incorporating experimental constraints can generate testable predictions about YNL174W function. This integrated approach follows the systems biology paradigm described in the literature, where understanding emerges from iterative cycles of data collection, modeling, and focused experimentation .

How do I effectively distinguish between direct and indirect effects in YNL174W functional studies?

Distinguishing direct from indirect effects in YNL174W studies requires strategic experimental design and careful data interpretation. Time-course experiments following YNL174W induction or inhibition help separate rapid primary responses from delayed secondary effects. For transcription factors, integration of binding data (ChIP-seq) with expression data (RNA-seq) identifies genes both bound and regulated by YNL174W, suggesting direct regulation. Inducible systems with translational inhibitors (like cycloheximide) can block secondary effects requiring protein synthesis. Mutational analysis of predicted functional domains helps correlate specific molecular activities with cellular phenotypes. In vitro biochemical assays with purified components provide definitive evidence of direct molecular interactions. Dose-response relationships can often distinguish direct effects (showing simple saturation kinetics) from indirect effects (showing more complex response patterns). Statistical methods like mediation analysis can quantify the contribution of intermediate factors to observed effects. This multifaceted approach ensures robust identification of direct YNL174W functions versus downstream consequences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.