Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNL179C (YNL179C)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YNL179C

Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YNL179C refers to a genetically engineered version of the protein encoded by the YNL179C gene in the baker's yeast, Saccharomyces cerevisiae. This protein is considered uncharacterized, meaning its specific biological functions and roles within the cell are not yet fully understood. The use of recombinant proteins like YNL179C involves expressing the protein in a controlled environment, often for research or therapeutic purposes.

Background on Saccharomyces cerevisiae

Saccharomyces cerevisiae, commonly known as baker's yeast, is a widely used model organism in molecular biology. It has an extensive history of safe use in both research and food production . The organism's genome is well-characterized, with the reference genome derived from the laboratory strain S288C . This strain is frequently used for genetic studies and recombinant protein production due to its well-understood genetic makeup.

Characteristics of YNL179C

  • Gene Information: The YNL179C gene is located in the Saccharomyces cerevisiae genome and encodes a protein of unknown function. The protein is available as a recombinant form, which can be produced in various strains of S. cerevisiae, including strain S288C .

  • Protein Availability: Recombinant YNL179C protein is available for purchase from biotechnology suppliers, often with specifications such as low endotoxin levels and storage at -20°C .

Potential Research Directions

Given the lack of detailed information on YNL179C's function, future research could focus on:

  • Functional Characterization: Investigating the role of YNL179C in cellular processes through genetic and biochemical analyses.

  • Protein-Protein Interactions: Examining potential interactions between YNL179C and other proteins within S. cerevisiae to understand its involvement in cellular networks.

  • Biotechnological Applications: Exploring the potential use of recombinant YNL179C in biotechnology, such as in vaccine development or as a tool for studying protein function.

References Yeast Genome Database. (2005). YNL179C | SGD - Saccharomyces Genome Database. EPA. (2015). FINAL RISK ASSESSMENT OF SACCHAROMYCES CEREVISIAE. Gavin et al. (2008). Up-to-date catalogues of yeast protein complexes. Gi-4000 Series Study. (2018). Whole Recombinant Saccharomyces cerevisiae Yeast Expressing... Li et al. (2024). A comparative study of the cryo-EM structures of Saccharomyces... Kim et al. (2024). The Involvement of YNR069C in Protein Synthesis in the Baker’s Yeast, Saccharomyces cerevisiae. MyBioSource. (2014). YNL179C recombinant protein | Putative uncharacterized protein...

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment accordingly.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its use.
Synonyms
YNL179C; N1648; Putative uncharacterized protein YNL179C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YNL179C
Target Protein Sequence
MSNCRRLLCRQLSSAYLNYLPFYFLIYRPFSLYLSSCEYWQSCFSFFFLFFLFFFFFFTF QFLVAFPILLFKVSLNSTLTKHVRPIHQRTKARSLTHHCIPKRWNIHFFFSGLLHKTISR IFSWIGNTRQVAPTKHTPKYLLNTI
Uniprot No.

Target Background

Database Links

STRING: 4932.YNL179C

Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.