Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNL203C (YNL203C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates. Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during manufacturing. The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YNL203C; N1358; Putative uncharacterized protein YNL203C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YNL203C
Target Protein Sequence
MEPFDFFNSFKHALAVLKLPSKSMSTTDLKAFGERFAKSHTKFPAAPAMTKSILPNFSTV FLTAFSTCSKLRTSTFAIAKTASLSFANCEIPFAACSVLSWSLPTIAALQPRRTKASVCT RHIVPAPPVTNATLPLNKSGLQEPSVTNLPSKVFAVFIVSMTRTYDLPNSKSVNIRNYEL LFKFRFSLIWSLTLIPILFGKLQ
Uniprot No.

Target Background

Database Links

STRING: 4932.YNL203C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How can I clone and express the YNL203C gene from Saccharomyces cerevisiae?

To clone and express YNL203C, employ a similar approach to that used for other yeast proteins such as Rrd1. Begin by amplifying the YNL203C gene using standard PCR with carefully designed primers that contain appropriate restriction sites. Clone the amplified gene into an expression vector such as pET21d(+), which contains a bacteriophage T7 inducible promoter and lac operator for controlled expression . For optimal expression in E. coli, consider codon optimization if initial expression attempts yield poor results. Transform the constructed plasmid into an appropriate E. coli strain such as BL21(DE3) and induce protein expression using IPTG at concentrations between 0.1-1.0 mM when the culture reaches mid-log phase (OD600 of 0.6-0.8) . Monitor expression levels through SDS-PAGE analysis at various time points post-induction to determine optimal harvesting time.

What purification strategy should I use for recombinant YNL203C protein?

Purify recombinant YNL203C using immobilized metal affinity chromatography (IMAC) as the primary purification step, similar to the approach used for Rrd1 protein . Design your expression construct to include a C-terminal or N-terminal His-tag to facilitate purification. After cell lysis (using sonication or pressure-based methods), clarify the lysate by centrifugation at approximately 12,000-15,000 g for 30 minutes. Load the clarified lysate onto a Ni-NTA column pre-equilibrated with binding buffer (typically containing 20-50 mM Tris-HCl pH 7.5-8.0, 300-500 mM NaCl, and 10-20 mM imidazole). Wash extensively with binding buffer, then elute the protein using a gradient or step-wise increase of imidazole (typically 50-300 mM) . Further purify the protein using size exclusion chromatography to ensure homogeneity and to determine its oligomeric state under native conditions.

How do I verify the identity and purity of recombinant YNL203C?

Verify the identity and purity of YNL203C through multiple complementary techniques. First, analyze the protein by SDS-PAGE to assess purity and confirm the expected molecular weight. Follow this with western blotting using either an antibody against the His-tag or a custom antibody generated against YNL203C if available . For more precise mass determination, employ mass spectrometry. Protein identity can be further confirmed through peptide mass fingerprinting after tryptic digestion. To assess homogeneity and determine the oligomeric state of the purified protein, utilize size exclusion chromatography, which will reveal whether YNL203C exists as a monomer or forms higher-order structures in solution . These combined approaches will provide comprehensive verification of protein identity and purity.

What initial structural characterization techniques should I apply to YNL203C?

Conduct initial structural characterization of YNL203C using spectroscopic techniques that require relatively small amounts of protein. Start with circular dichroism (CD) spectroscopy in the far-UV range (190-250 nm) to determine secondary structure content, looking for characteristic spectra that indicate the presence of α-helices (negative minima at 222 and 208 nm) or β-sheets (negative minimum at 215 nm) . Complement this with fluorescence spectroscopy to assess the tertiary structure and folding state by examining the intrinsic tryptophan and tyrosine fluorescence. A well-defined emission spectrum with a peak around 330-340 nm typically indicates properly folded proteins with buried tryptophans, while a red-shifted spectrum (>350 nm) suggests exposed aromatic residues or partial unfolding . Additionally, perform thermal stability studies using differential scanning fluorimetry to determine the melting temperature and stability of YNL203C under various buffer conditions.

How can I predict potential functions of YNL203C based on sequence analysis?

Employ a systematic bioinformatic approach to predict potential functions of YNL203C. Begin with sequence homology searches using BLAST against various protein databases to identify related proteins with known functions. Follow with domain prediction tools such as InterPro, Pfam, and SMART to identify conserved functional domains. Analyze the protein sequence for potential post-translational modification sites using tools like NetPhos for phosphorylation and NetNGlyc for glycosylation prediction. Utilize protein structure prediction programs such as AlphaFold2 or RoseTTAFold to generate structural models, then compare these with known structures using tools like DALI. Additionally, examine protein-protein interaction databases such as STRING to identify potential interaction partners based on co-expression patterns across different species. These complementary approaches will provide a holistic view of potential YNL203C functions based on its sequence characteristics and evolutionary relationships.

How do I determine the cellular localization of YNL203C in Saccharomyces cerevisiae?

To determine the cellular localization of YNL203C, employ both fluorescent protein tagging and biochemical fractionation approaches. For fluorescent tagging, create a C-terminal or N-terminal fusion of YNL203C with GFP or other fluorescent proteins using either plasmid-based expression or genomic integration. When designing the construct, incorporate a flexible linker (such as Gly-Ser repeats) between YNL203C and the fluorescent tag to minimize interference with protein folding and localization. Visualize the fusion protein using confocal microscopy and compare its distribution pattern with established organelle markers.

For biochemical verification, perform subcellular fractionation to separate major cellular compartments (cytosol, nucleus, mitochondria, ER, and vacuole) following standard protocols. Analyze each fraction by western blotting using antibodies against YNL203C or its tag, alongside antibodies against known markers for each compartment. This combined approach will provide robust evidence for the protein's subcellular localization and potential dynamic redistribution under different growth conditions or stress responses, similar to approaches used for studying environmental adaptation mechanisms in yeast .

What methods should I use to identify potential interacting partners of YNL203C?

Employ a multi-faceted approach to identify YNL203C interaction partners. Begin with affinity purification coupled with mass spectrometry (AP-MS) by creating a tandem affinity purification (TAP)-tagged version of YNL203C. Express this construct in yeast and perform pull-down experiments under various growth conditions to capture both stable and transient interactions. Process samples for mass spectrometry and analyze the results against appropriate negative controls to filter out non-specific binding proteins.

Complement this with yeast two-hybrid (Y2H) screening using YNL203C as bait against a comprehensive yeast cDNA library. For proteins that show positive interactions in both AP-MS and Y2H, perform bimolecular fluorescence complementation (BiFC) assays to visualize the interactions in their native cellular context. Additionally, utilize proximity-dependent biotin identification (BioID) by fusing a biotin ligase to YNL203C to identify proteins in close proximity within the cell. This comprehensive approach will generate a high-confidence interaction network that can provide valuable insights into YNL203C function, similar to methodologies used in characterizing other yeast proteins .

How can I design a knockout or knockdown experiment to study YNL203C function?

To study YNL203C function through gene deletion, leverage the well-established yeast knockout collection methodologies. Create a precise gene deletion using homologous recombination by designing primers that amplify a selectable marker (such as KanMX4) flanked by sequences homologous to regions immediately upstream and downstream of the YNL203C open reading frame. Transform this construct into haploid yeast strains and select transformants on appropriate selective media. Verify correct integration by PCR and sequencing of the junction regions.

For diploid strains, create heterozygous knockouts and then induce sporulation to generate haploid segregants for phenotypic analysis. If YNL203C proves essential, implement conditional systems such as the auxin-inducible degron (AID) system or place YNL203C under the control of a repressible promoter like GAL1. Monitor phenotypic changes in the knockout strain under various growth conditions, focusing particularly on stress responses, growth rates, and changes in central carbon metabolism fluxes . Additionally, perform complementation studies by reintroducing wild-type YNL203C or mutant variants to confirm that observed phenotypes are specifically due to YNL203C absence.

What approaches can I use to study post-translational modifications of YNL203C?

To comprehensively identify and characterize post-translational modifications (PTMs) of YNL203C, implement a workflow that combines enrichment strategies with high-resolution mass spectrometry. First, purify recombinant or endogenously expressed YNL203C using affinity tags. For phosphorylation analysis, enrich phosphopeptides using techniques such as immobilized metal affinity chromatography (IMAC) or titanium dioxide (TiO2) chromatography before mass spectrometry analysis.

For other modifications such as ubiquitination, SUMOylation, or acetylation, use specific antibodies or tagged versions of the modifiers (e.g., His-tagged ubiquitin) for enrichment prior to analysis. Perform mass spectrometry using electron transfer dissociation (ETD) or higher-energy collisional dissociation (HCD) fragmentation methods to precisely locate modification sites. Validate identified PTMs using site-specific antibodies if available, or through site-directed mutagenesis of the modified residues followed by functional assays. Additionally, examine whether these modifications change under different stress conditions, such as osmotic stress, which has been shown to significantly alter yeast central carbon metabolism and stress response mechanisms .

How can I investigate the role of YNL203C in specific metabolic pathways?

To investigate YNL203C's role in metabolic pathways, utilize the Yeast9 genome-scale metabolic model framework combined with experimental validation. Begin by generating a YNL203C deletion strain and perform comparative metabolomics using liquid chromatography-mass spectrometry (LC-MS) or gas chromatography-mass spectrometry (GC-MS) to identify metabolites with altered concentrations compared to wild-type cells. Focus particularly on central carbon metabolism pathways such as glycolysis, the pentose phosphate pathway (PPP), and the tricarboxylic acid (TCA) cycle, which show significant flux changes under stress conditions .

How can single-cell transcriptomics help understand the function of YNL203C under stress conditions?

Single-cell transcriptomics offers powerful insights into how YNL203C functions under stress conditions by revealing cell-to-cell variability that would be masked in bulk analysis. Implement a protocol similar to that used for studying osmotic stress response in yeast . Prepare single-cell suspensions of wild-type and YNL203C deletion strains under normal and stress conditions (e.g., osmotic, oxidative, or nutrient deprivation stress). Process cells using a droplet-based single-cell RNA sequencing platform such as 10x Genomics Chromium.

After sequencing, analyze the data using computational pipelines like Seurat or Scanpy to identify clusters of cells with similar expression profiles. Compare the transcriptomic landscapes between wild-type and YNL203C deletion strains to identify differentially expressed genes and altered pathways. Pay particular attention to heterogeneity within the population, as certain cells may exhibit resistant phenotypes or alternative stress response pathways . Integrate the transcriptomic data with constraint-based modeling approaches to create single-cell omics-constrained genome-scale models (scGEMs) that can predict metabolic flux distributions at the single-cell level. This approach will reveal how YNL203C influences cellular adaptation to stress and potentially explain the mechanisms of phenotypic heterogeneity observed in yeast populations.

What strategies can I use to integrate YNL203C into the Yeast9 genome-scale metabolic model?

To integrate YNL203C into the Yeast9 genome-scale metabolic model, follow a systematic approach that combines experimental data with bioinformatic predictions. First, gather all available experimental evidence regarding YNL203C's function, including phenotypic data from knockout strains, protein-protein interaction data, localization information, and any biochemical characterization. Next, use this information to hypothesize potential metabolic reactions that may involve YNL203C.

Implement these hypothesized reactions into the existing Yeast9 model framework using COBRA Toolbox or similar software . Perform model validation by comparing growth predictions under various conditions with experimental data from wild-type and YNL203C knockout strains. Refine the model iteratively based on discrepancies between predictions and experimental observations. Utilize techniques such as flux variability analysis (FVA) and flux sampling to explore the solution space and identify reactions most affected by YNL203C inclusion in the model.

Additionally, develop condition-specific models by integrating transcriptomic or proteomic data from cells under different environmental conditions, similar to the approach used for studying osmotic stress response . This integration will enable prediction of YNL203C's role in cellular adaptation to various stresses and provide testable hypotheses for further experimental validation.

How can I use genome-wide screens to identify genetic interactions of YNL203C?

Employ systematic genome-wide screening approaches to identify genetic interactions of YNL203C. Begin with synthetic genetic array (SGA) analysis by crossing a YNL203C deletion strain with the yeast deletion collection to generate double mutants. Analyze growth phenotypes of these double mutants to identify synthetic lethal or synthetic sick interactions, which indicate functional relationships or pathway redundancies.

For a complementary approach, perform a genome-wide CRISPR-Cas9 screen in a YNL203C deletion background, targeting the entire yeast genome for either knockout or CRISPRi-mediated knockdown. Design the screen to include both negative selection (identifying genes whose disruption is lethal or growth-inhibiting in the absence of YNL203C) and positive selection (identifying genes whose disruption rescues growth defects caused by YNL203C deletion).

Analyze the resulting interaction network using computational tools to identify enriched pathways and functional clusters. This approach has been successfully used in studies such as the genome-wide screen for enhanced noncanonical amino acid incorporation, where deletion of specific genes improved the efficiency of genetic code expansion . The identified genetic interactions will provide a systems-level understanding of YNL203C function and its position within cellular networks.

What advanced structural biology techniques are appropriate for studying YNL203C?

For comprehensive structural characterization of YNL203C, employ an integrated structural biology approach that combines multiple techniques. Begin with crystallization trials using purified, homogeneous YNL203C protein . Optimize crystallization conditions systematically, considering factors such as protein concentration, buffer composition, pH, temperature, and precipitants. Once crystals are obtained, perform X-ray diffraction experiments at a synchrotron facility to determine the atomic-resolution structure.

If crystallization proves challenging, employ cryo-electron microscopy (cryo-EM) as an alternative approach, particularly if YNL203C forms larger complexes with interaction partners. For dynamic structural information, implement nuclear magnetic resonance (NMR) spectroscopy, especially for studying protein-ligand interactions or conformational changes upon binding to partners or substrates.

Complement these high-resolution techniques with small-angle X-ray scattering (SAXS) to obtain information about protein shape, size, and conformational flexibility in solution. Additionally, use hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe protein dynamics and identify regions involved in interactions. Integrate all structural data with computational approaches such as molecular dynamics simulations to understand the functional implications of YNL203C's structure and dynamics.

How can I design experiments to study the role of YNL203C in responding to environmental stresses?

Design a comprehensive experimental strategy to investigate YNL203C's role in stress response by combining physiological, molecular, and systems biology approaches. First, assess the growth phenotypes of wild-type and YNL203C deletion strains under a panel of stress conditions including osmotic stress, oxidative stress, temperature stress, nutrient limitation, and chemical stressors at various concentrations and exposure times.

For conditions showing significant phenotypic differences, perform time-course transcriptomic and proteomic analyses to identify genes and proteins differentially regulated in the absence of YNL203C. Implement metabolomic profiling to detect changes in key metabolites and stress protectants such as glycerol, which is known to increase during osmotic stress .

Construct YNL203C variants with fluorescent tags to monitor changes in localization, abundance, or post-translational modifications during stress response. Employ single-cell analysis techniques to capture cell-to-cell variability in stress response, which can reveal subpopulations with distinct adaptation strategies . Additionally, use constraint-based modeling to predict metabolic flux redistributions in response to stress, comparing wild-type predictions with those for YNL203C deletion strains.

This multi-layered approach will provide comprehensive insights into YNL203C's role in stress response mechanisms, potentially revealing novel functions in cellular adaptation to environmental challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.