YNL266W is a gene in the S. cerevisiae S288C reference genome, encoding a protein of 139 amino acids (aa) with a predicted molecular weight of ~15.8 kDa (calculated from the sequence: MWLINHTYKLLSYFLRKASNRFFNSSSSSFSCSFLVFLFVVFFSDCFFSITSFLISFGILSSFLIFSLFCLGFLTVIGCLASALSLSSLSKAKIGFSSSLSSISPEGSLKSEEMLEDDEDKEFSSLLYGTSYVFAISFK) . Key features include:
| Property | Value | Source |
|---|---|---|
| Gene ID | YNL266W | SGD |
| UniProt ID | P53842 | |
| Length | 139 aa (Full Length) | |
| Host Organism for Production | E. coli | |
| Tag | N-terminal His-tag |
The protein is annotated as "uncharacterized," indicating no confirmed molecular function, biological process, or cellular component associations in databases like SGD .
Recombinant YNL266W is produced via heterologous expression in E. coli and purified to >90% purity using SDS-PAGE . Key specifications include:
| Parameter | Detail |
|---|---|
| Expression Host | E. coli (with His-tag) |
| Purity | >90% (SDS-PAGE) |
| Storage Buffer | Tris/PBS-based, 6% Trehalose, pH 8.0 |
| Reconstitution Instructions | Deionized sterile water (0.1–1.0 mg/mL) |
The His-tag facilitates affinity chromatography purification, enabling efficient isolation for downstream applications .
While YNL266W’s function remains elusive, its recombinant form supports exploratory research:
Antibodies against YNL266W (e.g., rabbit polyclonal IgG) enable:
Western Blot (WB): Detection in S. cerevisiae lysates.
| Reagent Type | Application | Host/Reactivity |
|---|---|---|
| Recombinant YNL266W | Biochemical assays, binding studies | E. coli |
| Rabbit Anti-YNL266W Antibody | Immunodetection | S. cerevisiae |
Cross-species sequence comparisons could reveal homologs and infer evolutionary roles. For example, BLAST searches in SGD enable alignment with fungal or eukaryotic orthologs .
No functional data (e.g., gene ontology annotations, phenotypes, or interactions) are documented for YNL266W in SGD or literature . This highlights the need for:
Knockout Studies: Assessing phenotypic changes in S. cerevisiae Δynl266w mutants.
Protein Interaction Mapping: Identifying binding partners via yeast two-hybrid or co-IP.
Metabolic Profiling: Linking YNL266W to pathways (e.g., amino acid metabolism, stress responses).
STRING: 4932.YNL266W
RNA analysis using RT-PCR and Northern blotting remains the gold standard for confirming transcription of hypothetical genes. For protein-level confirmation, targeted proteomics approaches using either epitope tagging or generation of specific antibodies are recommended. When designing experiments to confirm expression, consider both within-subjects and between-subjects designs to account for variability . For uncharacterized proteins, it's advisable to examine expression under multiple growth conditions, as some genes are only expressed under specific environmental stresses or growth phases.
A structured bioinformatic workflow combining multiple tools is recommended for predicting function. Begin with sequence homology searches (BLAST, HMM profiles) against characterized proteins, followed by structural prediction (AlphaFold2, I-TASSER), conserved domain analysis, and phylogenetic profiling. For annotation of hypothetical proteins, integrate results from multiple databases rather than relying on a single predictive tool . This multi-faceted approach has successfully assigned functions to previously uncharacterized proteins in other organisms, revealing roles in fundamental cellular processes including cell wall organization and ATP hydrolysis .
The choice of tagging strategy depends on experimental goals:
| Tag Type | Advantages | Limitations | Best Used For |
|---|---|---|---|
| N-terminal | Less likely to disrupt C-terminal motifs | May interfere with signal sequences | Proteins without N-terminal signals |
| C-terminal | Preserves native N-terminus | May disrupt C-terminal localization signals | Proteins without C-terminal motifs |
| Internal | Minimizes disruption of terminal domains | Complex design, may affect folding | Large proteins with well-defined domains |
For initial characterization studies, both N- and C-terminal tagging approaches should be tested to determine which maintains protein function. Commonly used epitope tags include FLAG, HA, and 6xHis. For hypothetical proteins, consider a dual-tagging approach to facilitate both detection and purification.
When designing experiments to characterize deletion phenotypes, implement both positive and negative controls. A full factorial design with at least two independent variables is recommended for rigorous analysis . Essential controls include:
Wild-type strain (isogenic background)
Complementation with the YNL266W gene to confirm phenotype rescue
Deletion of known genes with similar predicted functions
Empty vector controls for complementation studies
A multi-method approach yields the most reliable results for identifying protein interactions:
Affinity Purification-Mass Spectrometry (AP-MS): Use tagged YNL266W to pull down interaction partners, followed by LC-MS/MS identification. This approach should include stringent controls including untransfected cells and cells expressing the tag alone.
Yeast Two-Hybrid Screening: Construct both bait and prey fusion proteins to screen for binary interactions. Consider both N- and C-terminal fusions to minimize false negatives.
Proximity-Dependent Labeling: BioID or TurboID fusions can identify proteins in close proximity in their native cellular environment.
Co-immunoprecipitation: Validate high-confidence interactions using reciprocal co-IP experiments.
For all interaction studies, replicate experimental conditions are essential, and data should be analyzed using appropriate statistical methods to distinguish between true interactions and background noise.
Given S. cerevisiae's established role as a model for studying RNA-mediated processes , several methodologies can elucidate YNL266W's potential involvement:
RNA Immunoprecipitation (RIP): Use tagged YNL266W to identify associated RNA molecules.
CLIP-seq (UV Cross-Linking and Immunoprecipitation): Provides higher resolution of RNA-protein interaction sites.
Ribosome Profiling: Compare translational profiles between wild-type and YNL266W deletion strains to identify effects on translation.
Transcriptome Analysis: RNA-seq analysis comparing wild-type and YNL266W mutants can reveal changes in gene expression, splicing patterns, or RNA stability.
Genetic Interactions: Conduct systematic genetic interaction screens with known RNA-processing factors.
S. cerevisiae provides an excellent model for these studies due to its well-characterized genome and the high conservation of RNA-processing machinery across eukaryotes .
To investigate potential roles in metabolism, implement a systematic approach comparing wild-type and YNL266W deletion strains:
Growth Profiling: Measure growth rates on different carbon sources (glucose, galactose, xylose, etc.). Create a comprehensive phenotypic profile across multiple nutrient conditions.
Metabolite Analysis: Employ GC-MS or LC-MS to quantify intracellular and extracellular metabolites.
Flux Analysis: Use 13C-labeled substrates to trace carbon flow through central metabolic pathways.
Gene Expression Analysis: Monitor expression of key metabolic genes in response to YNL266W deletion using RT-qPCR or RNA-seq.
Enzymatic Assays: Measure activities of key metabolic enzymes in wild-type versus deletion strains.
If YNL266W affects carbon source utilization, you may observe changes similar to those seen in engineered strains with altered metabolic pathways . For example, in xylose metabolism studies, gene expression analysis revealed significant changes in TCA cycle and respiratory enzyme transcripts when yeast was grown on different carbon sources .
Uncharacterized proteins often present detection challenges. If initial experiments fail to detect YNL266W expression:
Optimize Growth Conditions: Test multiple growth phases and stress conditions, as some genes are only expressed under specific circumstances.
Enhance Sensitivity: Use targeted proteomics approaches like Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM) for low-abundance proteins.
Improve Extraction Methods: Test different protein extraction protocols optimized for different cellular compartments.
Codon Optimization: For recombinant expression, consider codon optimization based on S. cerevisiae codon usage preferences.
Stabilize the Protein: Include protease inhibitors and optimize buffer conditions to prevent degradation.
Similar approaches have successfully detected low-abundance hypothetical proteins in other organisms, revealing their functional significance .
When facing contradictory results:
Methodological Validation: Carefully review experimental designs for potential confounding variables. Consider whether the study design was between-subjects or within-subjects and how this might affect interpretation .
Strain Background Effects: Test the phenotype in multiple strain backgrounds to rule out genetic interactions specific to one background.
Compensatory Mechanisms: Investigate potential redundancy or compensatory pathways that may mask phenotypes in deletion studies.
Condition-Specific Functions: Expand testing to a broader range of environmental conditions, as functions may only be revealed under specific stresses.
Integrate Multiple Data Types: Combine genetic, biochemical, and computational approaches to build a more complete picture of function.
Temporal Considerations: Examine whether the protein's function varies across different growth phases or cell cycle stages.
For robust data analysis:
Determine Appropriate Sample Size: Power analysis should guide experimental design to ensure sufficient statistical power.
Multiple Testing Correction: When performing genome-wide studies (transcriptomics, proteomics), apply appropriate corrections (FDR, Bonferroni) for multiple comparisons.
Biological Replicates: Include at least three biological replicates and technical replicates to assess variability.
Normalization Methods: Select appropriate normalization strategies for the specific data type (e.g., RPKM for RNA-seq, TMM for proteomics).
Visualization: Use principal component analysis (PCA) and hierarchical clustering to identify patterns in high-dimensional data.
Pathway Enrichment: Employ tools like GO enrichment, KEGG pathway analysis, or gene set enrichment analysis (GSEA) to identify affected biological processes.
For reproducible research, deposit all raw data in appropriate repositories following FAIR principles (Findable, Accessible, Interoperable, and Reusable).