Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNL266W (YNL266W)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

YNL266W is a gene in the S. cerevisiae S288C reference genome, encoding a protein of 139 amino acids (aa) with a predicted molecular weight of ~15.8 kDa (calculated from the sequence: MWLINHTYKLLSYFLRKASNRFFNSSSSSFSCSFLVFLFVVFFSDCFFSITSFLISFGILSSFLIFSLFCLGFLTVIGCLASALSLSSLSKAKIGFSSSLSSISPEGSLKSEEMLEDDEDKEFSSLLYGTSYVFAISFK) . Key features include:

PropertyValueSource
Gene IDYNL266WSGD
UniProt IDP53842
Length139 aa (Full Length)
Host Organism for ProductionE. coli
TagN-terminal His-tag

The protein is annotated as "uncharacterized," indicating no confirmed molecular function, biological process, or cellular component associations in databases like SGD .

Production and Purification

Recombinant YNL266W is produced via heterologous expression in E. coli and purified to >90% purity using SDS-PAGE . Key specifications include:

ParameterDetail
Expression HostE. coli (with His-tag)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based, 6% Trehalose, pH 8.0
Reconstitution InstructionsDeionized sterile water (0.1–1.0 mg/mL)

The His-tag facilitates affinity chromatography purification, enabling efficient isolation for downstream applications .

Research Applications

While YNL266W’s function remains elusive, its recombinant form supports exploratory research:

Functional Screens

Antibodies against YNL266W (e.g., rabbit polyclonal IgG) enable:

  • Western Blot (WB): Detection in S. cerevisiae lysates.

  • ELISA: Quantification of protein expression levels .

Reagent TypeApplicationHost/Reactivity
Recombinant YNL266WBiochemical assays, binding studiesE. coli
Rabbit Anti-YNL266W AntibodyImmunodetectionS. cerevisiae

Comparative Genomics

Cross-species sequence comparisons could reveal homologs and infer evolutionary roles. For example, BLAST searches in SGD enable alignment with fungal or eukaryotic orthologs .

Current Research Gaps

No functional data (e.g., gene ontology annotations, phenotypes, or interactions) are documented for YNL266W in SGD or literature . This highlights the need for:

  1. Knockout Studies: Assessing phenotypic changes in S. cerevisiae Δynl266w mutants.

  2. Protein Interaction Mapping: Identifying binding partners via yeast two-hybrid or co-IP.

  3. Metabolic Profiling: Linking YNL266W to pathways (e.g., amino acid metabolism, stress responses).

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if you have specific requirements. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped standard with blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize developing the specified tag.
Synonyms
YNL266W; N0800; Putative uncharacterized protein YNL266W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YNL266W
Target Protein Sequence
MWLINHTYKLLSYFLRKASNRFFNSSSSSFSCSFLVFLFVVFFSDCFFSITSFLISFGIL SSFLIFSLFCLGFLTVIGCLASALSLSSLSKAKIGFSSSLSSISPEGSLKSEEMLEDDED KEFSSLLYGTSYVFAISFK
Uniprot No.

Target Background

Database Links

STRING: 4932.YNL266W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What approaches should be used to confirm expression of the YNL266W gene in wild-type yeast?

RNA analysis using RT-PCR and Northern blotting remains the gold standard for confirming transcription of hypothetical genes. For protein-level confirmation, targeted proteomics approaches using either epitope tagging or generation of specific antibodies are recommended. When designing experiments to confirm expression, consider both within-subjects and between-subjects designs to account for variability . For uncharacterized proteins, it's advisable to examine expression under multiple growth conditions, as some genes are only expressed under specific environmental stresses or growth phases.

What bioinformatic approaches can predict the potential function of YNL266W?

A structured bioinformatic workflow combining multiple tools is recommended for predicting function. Begin with sequence homology searches (BLAST, HMM profiles) against characterized proteins, followed by structural prediction (AlphaFold2, I-TASSER), conserved domain analysis, and phylogenetic profiling. For annotation of hypothetical proteins, integrate results from multiple databases rather than relying on a single predictive tool . This multi-faceted approach has successfully assigned functions to previously uncharacterized proteins in other organisms, revealing roles in fundamental cellular processes including cell wall organization and ATP hydrolysis .

How should recombinant YNL266W be tagged for detection and purification?

The choice of tagging strategy depends on experimental goals:

Tag TypeAdvantagesLimitationsBest Used For
N-terminalLess likely to disrupt C-terminal motifsMay interfere with signal sequencesProteins without N-terminal signals
C-terminalPreserves native N-terminusMay disrupt C-terminal localization signalsProteins without C-terminal motifs
InternalMinimizes disruption of terminal domainsComplex design, may affect foldingLarge proteins with well-defined domains

For initial characterization studies, both N- and C-terminal tagging approaches should be tested to determine which maintains protein function. Commonly used epitope tags include FLAG, HA, and 6xHis. For hypothetical proteins, consider a dual-tagging approach to facilitate both detection and purification.

What controls are essential when characterizing the phenotype of YNL266W deletion mutants?

When designing experiments to characterize deletion phenotypes, implement both positive and negative controls. A full factorial design with at least two independent variables is recommended for rigorous analysis . Essential controls include:

  • Wild-type strain (isogenic background)

  • Complementation with the YNL266W gene to confirm phenotype rescue

  • Deletion of known genes with similar predicted functions

  • Empty vector controls for complementation studies

How should researchers design experiments to identify potential interaction partners of YNL266W?

A multi-method approach yields the most reliable results for identifying protein interactions:

  • Affinity Purification-Mass Spectrometry (AP-MS): Use tagged YNL266W to pull down interaction partners, followed by LC-MS/MS identification. This approach should include stringent controls including untransfected cells and cells expressing the tag alone.

  • Yeast Two-Hybrid Screening: Construct both bait and prey fusion proteins to screen for binary interactions. Consider both N- and C-terminal fusions to minimize false negatives.

  • Proximity-Dependent Labeling: BioID or TurboID fusions can identify proteins in close proximity in their native cellular environment.

  • Co-immunoprecipitation: Validate high-confidence interactions using reciprocal co-IP experiments.

For all interaction studies, replicate experimental conditions are essential, and data should be analyzed using appropriate statistical methods to distinguish between true interactions and background noise.

What approaches can determine if YNL266W is involved in RNA-mediated processes?

Given S. cerevisiae's established role as a model for studying RNA-mediated processes , several methodologies can elucidate YNL266W's potential involvement:

  • RNA Immunoprecipitation (RIP): Use tagged YNL266W to identify associated RNA molecules.

  • CLIP-seq (UV Cross-Linking and Immunoprecipitation): Provides higher resolution of RNA-protein interaction sites.

  • Ribosome Profiling: Compare translational profiles between wild-type and YNL266W deletion strains to identify effects on translation.

  • Transcriptome Analysis: RNA-seq analysis comparing wild-type and YNL266W mutants can reveal changes in gene expression, splicing patterns, or RNA stability.

  • Genetic Interactions: Conduct systematic genetic interaction screens with known RNA-processing factors.

S. cerevisiae provides an excellent model for these studies due to its well-characterized genome and the high conservation of RNA-processing machinery across eukaryotes .

How can researchers determine if YNL266W affects metabolic pathways like carbohydrate utilization?

To investigate potential roles in metabolism, implement a systematic approach comparing wild-type and YNL266W deletion strains:

  • Growth Profiling: Measure growth rates on different carbon sources (glucose, galactose, xylose, etc.). Create a comprehensive phenotypic profile across multiple nutrient conditions.

  • Metabolite Analysis: Employ GC-MS or LC-MS to quantify intracellular and extracellular metabolites.

  • Flux Analysis: Use 13C-labeled substrates to trace carbon flow through central metabolic pathways.

  • Gene Expression Analysis: Monitor expression of key metabolic genes in response to YNL266W deletion using RT-qPCR or RNA-seq.

  • Enzymatic Assays: Measure activities of key metabolic enzymes in wild-type versus deletion strains.

If YNL266W affects carbon source utilization, you may observe changes similar to those seen in engineered strains with altered metabolic pathways . For example, in xylose metabolism studies, gene expression analysis revealed significant changes in TCA cycle and respiratory enzyme transcripts when yeast was grown on different carbon sources .

What strategies can overcome difficulties in detecting expression of YNL266W?

Uncharacterized proteins often present detection challenges. If initial experiments fail to detect YNL266W expression:

  • Optimize Growth Conditions: Test multiple growth phases and stress conditions, as some genes are only expressed under specific circumstances.

  • Enhance Sensitivity: Use targeted proteomics approaches like Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM) for low-abundance proteins.

  • Improve Extraction Methods: Test different protein extraction protocols optimized for different cellular compartments.

  • Codon Optimization: For recombinant expression, consider codon optimization based on S. cerevisiae codon usage preferences.

  • Stabilize the Protein: Include protease inhibitors and optimize buffer conditions to prevent degradation.

Similar approaches have successfully detected low-abundance hypothetical proteins in other organisms, revealing their functional significance .

How should researchers address conflicting data about YNL266W function from different experimental approaches?

When facing contradictory results:

  • Methodological Validation: Carefully review experimental designs for potential confounding variables. Consider whether the study design was between-subjects or within-subjects and how this might affect interpretation .

  • Strain Background Effects: Test the phenotype in multiple strain backgrounds to rule out genetic interactions specific to one background.

  • Compensatory Mechanisms: Investigate potential redundancy or compensatory pathways that may mask phenotypes in deletion studies.

  • Condition-Specific Functions: Expand testing to a broader range of environmental conditions, as functions may only be revealed under specific stresses.

  • Integrate Multiple Data Types: Combine genetic, biochemical, and computational approaches to build a more complete picture of function.

  • Temporal Considerations: Examine whether the protein's function varies across different growth phases or cell cycle stages.

What statistical approaches are most appropriate for analyzing high-throughput data involving YNL266W?

For robust data analysis:

  • Determine Appropriate Sample Size: Power analysis should guide experimental design to ensure sufficient statistical power.

  • Multiple Testing Correction: When performing genome-wide studies (transcriptomics, proteomics), apply appropriate corrections (FDR, Bonferroni) for multiple comparisons.

  • Biological Replicates: Include at least three biological replicates and technical replicates to assess variability.

  • Normalization Methods: Select appropriate normalization strategies for the specific data type (e.g., RPKM for RNA-seq, TMM for proteomics).

  • Visualization: Use principal component analysis (PCA) and hierarchical clustering to identify patterns in high-dimensional data.

  • Pathway Enrichment: Employ tools like GO enrichment, KEGG pathway analysis, or gene set enrichment analysis (GSEA) to identify affected biological processes.

For reproducible research, deposit all raw data in appropriate repositories following FAIR principles (Findable, Accessible, Interoperable, and Reusable).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.