Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNL324W (YNL324W)

What is YNL324W and what do we currently know about its structure?

YNL324W is a putative uncharacterized protein from Saccharomyces cerevisiae consisting of 131 amino acids. The full amino acid sequence is: "MNPRRPYPVIFLCRPSSVASSKLASTFMISFLVKKTLSSNTVNSPRGTVRSISRIRNMVSLLLLPTIYIRSLVSYNVYLPITNLEVFLCLDPDVVSIPPPRVCSIASLFILVLFLFCFALRYYVSKLINFK" . Based on sequence analysis, it contains hydrophobic regions that may indicate membrane association, although its precise cellular localization and function remain undetermined. As an uncharacterized protein, it represents an opportunity for novel discovery in yeast biology.

Which expression systems yield optimal results for recombinant YNL324W production?

Multiple expression systems have been evaluated for YNL324W production, with E. coli and yeast offering the best yields and shorter turnaround times . For basic characterization studies where post-translational modifications may not be critical, E. coli expression with an N-terminal His-tag has been successfully employed and can achieve purity greater than 90% as determined by SDS-PAGE . When native folding and potential post-translational modifications are essential, expression in its native host S. cerevisiae is preferable. For more comprehensive studies requiring specific modifications, insect cells with baculovirus or mammalian cell expression systems can provide many of the post-translational modifications necessary for correct protein folding or activity retention .

What are the optimal storage and handling conditions for purified recombinant YNL324W?

Purified recombinant YNL324W is typically stored as a lyophilized powder for maximum stability . For reconstitution, it should be briefly centrifuged prior to opening, then dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, addition of 5-50% glycerol (final concentration) is recommended, followed by aliquoting and storage at -20°C/-80°C . The standard final concentration of glycerol in commercial preparations is 50%. Working aliquots can be stored at 4°C for up to one week, and repeated freeze-thaw cycles should be strictly avoided to maintain protein integrity. Commercial preparations typically use a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

How can researchers confirm the identity and purity of recombinant YNL324W?

A multi-analytical approach is necessary to confirm identity and assess purity:

• SDS-PAGE analysis: To evaluate purity, with commercial preparations typically achieving >90% purity .

• Western blot analysis: Using anti-His antibodies for detection of the N-terminal His-tag.

• Mass spectrometry:

  • Peptide mass fingerprinting following tryptic digestion

  • Intact protein mass analysis to confirm full-length expression

• N-terminal sequencing: To verify the correct starting amino acid and proper tag fusion.

• Size exclusion chromatography: To assess monodispersity and detect potential aggregates.

This analytical package ensures both identity confirmation and purity assessment before proceeding with functional studies.

What experimental approaches can determine the subcellular localization of YNL324W?

Since YNL324W contains hydrophobic regions suggesting possible membrane association, determining its subcellular localization is critical. Recommended approaches include:

• Fluorescent protein fusion constructs:

  • C-terminal or N-terminal GFP fusion expressed in S. cerevisiae

  • Live-cell imaging with co-localization markers for specific organelles

• Immunofluorescence microscopy:

  • Using antibodies against the native protein or epitope tags

  • Co-staining with organelle-specific markers

• Subcellular fractionation:

  • Differential centrifugation to separate cellular compartments

  • Western blot analysis of fractions to detect YNL324W

  • Comparison with known markers for different cellular compartments

• Protease protection assays:

  • For determining topology if membrane-associated

  • Differential accessibility to proteases with/without membrane permeabilization

• Computational prediction:

  • Transmembrane domain prediction using algorithms like TMHMM

  • Signal peptide prediction using SignalP

These combined approaches would provide comprehensive evidence for YNL324W's localization, offering initial clues to its function.

What strategies can effectively characterize the function of YNL324W?

Characterizing the function of an uncharacterized protein requires a multi-faceted approach:

• Comparative genomics:

  • Identification of homologs in other species with known functions

  • Detection of conserved domains or motifs

• Gene deletion analysis:

  • Generation of YNL324W knockout strains

  • Phenotypic screening under various conditions (temperature, pH, nutrient limitations, stress conditions)

  • Growth rate analysis and morphological examination

• Synthetic genetic interactions:

  • Synthetic genetic array (SGA) analysis

  • Identification of genetic interactions through double mutant analysis

• Transcriptomic analysis:

  • RNA-seq comparing wild-type and YNL324W deletion strains

  • Expression profiling under different conditions

• Protein interaction studies:

  • Affinity purification coupled with mass spectrometry

  • Yeast two-hybrid screening

  • Proximity labeling approaches (BioID)

• Metabolomic profiling:

  • Comparison of metabolite profiles between wild-type and deletion strains

  • Identification of altered metabolic pathways

This systematic approach would generate multiple lines of evidence converging on potential functions, providing a foundation for targeted follow-up experiments.

How might YNL324W contribute to recombinant protein production capabilities in Saccharomyces cerevisiae?

Saccharomyces cerevisiae is widely utilized as a host for recombinant protein production due to its well-studied genome, ability to secrete large and post-translationally modified proteins, fast growth, and cost-effective culturing . Recent research has identified non-laboratory strains with enhanced capacity for recombinant protein production, revealing several potential pathways driving the improved expression phenotype, including changes in carbohydrate catabolism, thiamine biosynthesis, transmembrane transport, and vacuolar degradation .

Understanding YNL324W's function could impact recombinant protein production strategies:

• If YNL324W functions in any of these identified pathways, its manipulation could enhance expression yields.

• Targeted deletion of specific genes (like HXT11, PRM8/9, or SSE1) has already been shown to significantly improve recombinant protein production in laboratory strains .

• If YNL324W plays a role in protein folding, trafficking, or quality control, its modulation could improve the efficiency of heterologous protein expression.

• YNL324W characterization could lead to identification of novel genetic targets for strain engineering to leverage the natural diversity of S. cerevisiae for improved recombinant protein yields.

What methods are most effective for studying potential post-translational modifications of YNL324W?

Post-translational modifications (PTMs) often regulate protein function and can be critical for understanding an uncharacterized protein's role. For YNL324W, a comprehensive PTM analysis would include:

• Mass spectrometry-based approaches:

  • Enrichment strategies for specific PTMs (phosphopeptides, glycopeptides)

  • High-resolution MS/MS for site localization

  • Quantitative analysis of modification stoichiometry

• Comparative expression system analysis:

  • Expression in E. coli (minimal PTMs) versus yeast, insect, or mammalian cells

  • Detection of molecular weight shifts or changes in activity

• Site-directed mutagenesis:

  • Mutation of predicted modification sites

  • Functional assessment of mutants

• Specific detection methods:

  • Phospho-specific antibodies

  • Glycan-specific staining

  • Pro-Q Diamond for phosphorylation

  • Biotin-switch techniques for redox modifications

• Computational prediction:

  • PTM site prediction using algorithms specific for different modifications

  • Integration with structural predictions to identify accessible residues

Understanding the PTM landscape would provide crucial insights into YNL324W regulation and potentially reveal condition-specific functions.

How can researchers design definitive experiments to determine if YNL324W is membrane-associated?

The amino acid sequence of YNL324W contains hydrophobic stretches that suggest potential membrane association . To definitively determine membrane association:

• Membrane extraction experiments:

  • Treatment with increasing concentrations of detergents

  • Carbonate extraction (pH 11) to differentiate peripheral vs. integral membrane proteins

  • Phase separation with Triton X-114

• Fluorescent protein fusions:

  • Live-cell imaging of GFP-YNL324W fusions

  • Photobleaching experiments (FRAP) to assess mobility

• Membrane integration analysis:

  • Proteinase K protection assays with isolated membrane fractions

  • Selective permeabilization of different cellular membranes

• Liposome reconstitution:

  • In vitro reconstitution with artificial liposomes

  • Analysis of protein orientation and topology

• Cysteine accessibility methods:

  • Introduction of cysteine residues at key positions

  • Selective labeling with membrane-permeable vs. impermeable reagents

This experimental package would provide conclusive evidence regarding YNL324W's membrane association and topology, critical information for functional hypotheses.

What control experiments are essential when investigating YNL324W protein-protein interactions?

When investigating protein-protein interactions of an uncharacterized protein, rigorous controls are crucial:

• Negative controls:

  • Empty vector/bait constructs to identify false positives

  • Unrelated proteins with similar properties (size, charge, localization)

  • Scrambled or mutated YNL324W sequences

• Positive controls:

  • Known interaction partners for the method (if available)

  • Artificially engineered interaction pairs

• Validation across multiple methods:

  • Confirmation of interactions by at least two independent techniques

  • Reciprocal experiments (e.g., both A→B and B→A pull-downs)

• Specificity controls:

  • Competition assays with unlabeled protein

  • Titration experiments to assess concentration dependence

  • Structural mutants that should disrupt specific interactions

• Biological relevance controls:

  • Correlation with co-localization in cells

  • Co-expression analysis under various conditions

  • Functional assays to assess biological significance

This comprehensive control strategy ensures that identified interactions are specific, reproducible, and biologically meaningful.

How should conflicting results from different expression systems be reconciled when studying YNL324W?

When different expression systems yield conflicting results for YNL324W properties or functions, a systematic reconciliation approach is necessary:

• Protein authenticity verification:

  • Confirm sequence identity in each system

  • Verify tag position and linker effects

  • Assess potential proteolytic processing

• Post-translational modification analysis:

  • Compare PTM profiles between systems

  • Determine if functional differences correlate with specific modifications

  • Consider that E. coli lacks many eukaryotic PTMs while yeast, insect, and mammalian cells offer increasing complexity of modifications

• Folding and structural analysis:

  • Circular dichroism to compare secondary structure

  • Limited proteolysis to assess conformational differences

  • Thermal stability assessment

• Context-dependent interactions:

  • Identify system-specific interaction partners

  • Evaluate co-factors present in native but not heterologous systems

• Native context experiments:

  • Return to S. cerevisiae for validation

  • Use genomic integration rather than plasmid-based expression

  • Control expression levels to match physiological conditions

This systematic approach acknowledges that different expression systems may reveal distinct aspects of YNL324W biology, all potentially valid in specific contexts.

What bioinformatic analyses should be performed to generate testable hypotheses about YNL324W function?

A comprehensive bioinformatic analysis pipeline for YNL324W would include:

• Sequence-based analyses:

  • Position-Specific Iterated BLAST (PSI-BLAST) for remote homologs

  • Multiple sequence alignment with orthologs/paralogs

  • Conserved domain search and motif identification

  • Disorder prediction and secondary structure prediction

• Structural predictions:

  • AlphaFold2 modeling of tertiary structure

  • Identification of structural homologs using fold recognition

  • Prediction of binding pockets or active sites

  • Molecular dynamics simulations to assess flexibility

• Genomic context analysis:

  • Synteny conservation across related species

  • Co-expression networks from public datasets

  • Promoter analysis for regulatory elements

• Pathway and network integration:

  • Protein-protein interaction network neighborhood

  • Metabolic pathway mapping

  • Enrichment analysis of connected genes/proteins

  • Bayesian integration of multiple data types

• Phylogenetic profiling:

  • Presence/absence patterns across species

  • Correlation with specific traits or capabilities

  • Evolutionary rate analysis

This multi-layered computational approach generates testable hypotheses about YNL324W function that can be prioritized for experimental validation.

How can CRISPR-Cas9 technology be optimized for studying YNL324W function in Saccharomyces cerevisiae?

CRISPR-Cas9 offers powerful approaches for studying uncharacterized proteins like YNL324W:

• Precise genomic modifications:

  • Complete gene deletion with scarless removal

  • Introduction of point mutations to test specific hypotheses

  • C-terminal tagging at the endogenous locus

• Conditional allele creation:

  • Integration of inducible degradation tags (AID system)

  • Creation of temperature-sensitive alleles

  • Installation of synthetic regulatory elements

• Multiplexed editing:

  • Simultaneous modification of YNL324W and potential interaction partners

  • Creation of double/triple mutants to assess genetic interactions

• Optimization parameters:

  • Guide RNA design with minimal off-target effects

  • Repair template optimization with homology arms >40 bp

  • Transformation protocol adjustments for highest efficiency

  • Selection marker strategy (positive/negative selection)

• Screening considerations:

  • Design of efficient screening primers

  • Colony PCR protocols for high-throughput verification

  • Sequencing confirmation of intended modifications

This CRISPR-based toolkit enables precise manipulation of YNL324W in its native genomic context, providing more physiologically relevant insights than heterologous expression systems.

What mass spectrometry approaches are most suitable for defining the YNL324W interactome?

For comprehensive characterization of the YNL324W protein interaction network:

• Affinity purification-mass spectrometry (AP-MS):

  • Tag-based purification (His, FLAG, or TAP tags)

  • Both native and crosslinked conditions

  • SILAC or TMT labeling for quantitative comparison

  • Statistical filtering using SAINT or similar algorithms

• Proximity-dependent labeling:

  • BioID or TurboID fusion with YNL324W

  • APEX2 proximity labeling if membrane-associated

  • Time-course experiments to distinguish stable vs. transient interactions

• Crosslinking mass spectrometry (XL-MS):

  • Chemical crosslinking with MS-cleavable linkers

  • Analysis of crosslinked peptides for interaction interfaces

  • Integration with structural predictions

• Targeted interaction validation:

  • Selected/Multiple Reaction Monitoring (SRM/MRM)

  • Parallel Reaction Monitoring (PRM) for candidate interactors

  • Heavy-labeled peptide standards for absolute quantification

• Data analysis considerations:

  • Stringent filtering against control datasets

  • Network visualization and enrichment analysis

  • Integration with publicly available interaction datasets

  • Correlation with co-expression data

This comprehensive MS approach would define not only the components of YNL324W complexes but also provide structural insights into the interaction interfaces and their dynamics.

How might insights from YNL324W characterization advance synthetic biology applications in yeast?

Understanding YNL324W could impact several areas of synthetic biology:

• Recombinant protein production enhancement:

  • If involved in protein folding or secretion pathways, optimization could improve yield

  • Integration into existing strain engineering strategies that focus on carbohydrate metabolism, thiamine biosynthesis, transmembrane transport, and vacuolar degradation pathways

• Biosensor development:

  • If responsive to specific conditions, YNL324W could be engineered as a biosensor component

  • Fusion with reporter proteins for monitoring cellular states

• Synthetic circuit design:

  • Incorporation into genetic circuits if YNL324W has regulatory functions

  • Utilization of YNL324W promoter elements if they have unique properties

• Metabolic engineering:

  • If involved in metabolic regulation, manipulation could enhance production of valuable metabolites

  • Integration with existing metabolic models for more accurate predictions

• Minimal genome projects:

  • Determination if YNL324W is essential under specific conditions

  • Assessment for inclusion in minimal engineered S. cerevisiae genomes

Recent studies identified 20 non-laboratory strains with higher capacity to produce active recombinant proteins, with genomic and proteomic analyses revealing several potential pathways driving the improved expression phenotype . Characterization of uncharacterized proteins like YNL324W may reveal additional genetic targets for strain improvement.

What interdisciplinary approaches could accelerate functional discovery for YNL324W?

Accelerating functional discovery requires integration of multiple disciplines:

• Systems biology integration:

  • Multi-omics data integration (genomics, transcriptomics, proteomics, metabolomics)

  • Network modeling to predict functional relationships

  • Flux balance analysis to identify metabolic impacts

• Structural biology approaches:

  • Cryo-EM for complex structure determination

  • X-ray crystallography for high-resolution structure

  • NMR for dynamic regions and interaction mapping

• Chemical biology tools:

  • Small molecule screening for modulators of YNL324W activity

  • Activity-based protein profiling

  • Chemogenetic approaches for conditional control

• Single-cell technologies:

  • Single-cell transcriptomics to identify cell state-specific effects

  • Microfluidics for real-time phenotypic analysis

  • High-content screening for morphological impacts

• Computational prediction with experimental validation:

  • Machine learning approaches trained on known protein functions

  • Molecular dynamics simulations to predict conformational changes

  • Virtual screening for potential ligands

This interdisciplinary strategy leverages diverse expertise to accelerate functional characterization beyond what any single approach could achieve, particularly valuable for challenging uncharacterized proteins like YNL324W.