Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNR025C (YNR025C)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNR025C (YNR025C) is a protein of unknown function derived from Saccharomyces cerevisiae (Baker's yeast) . Saccharomyces cerevisiae is a frequently utilized model organism in the study of cation tolerance . It has been used since ancient times in winemaking, baking, and brewing .

Basic Characteristics

CharacteristicDescription
SpeciesSaccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
UniProt No.P53726
Amino Acid SequenceMTNTKKILHNALYYVLIIIYEYVLLLVHCLRYFFEFLFLFLPLWLVFFFLMLSLNNLSRSYSSSPSSWLPVNSLSLASLFSSSFCSPSSNFLFLEPLSSELSPKVFLPLITPSGFRSSL
Sequence Length1-119
Gene NameYNR025C
Other NamesPutative uncharacterized protein YNR025C, Ordered Locus Names: YNR025C, ORF Names: N3235
Expression RegionFull length protein
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
Storage InstructionsStore at -20℃, for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week .

Function and Regulation

As the name suggests, YNR025C is a putative uncharacterized protein, and thus, its precise function remains unknown . Studies on Saccharomyces cerevisiae have revealed information on other proteins and their functions, such as:

  • APC/C Complex: The anaphase-promoting complex/cyclosome (APC/C) is an E3 ubiquitin ligase that regulates cell cycle progression . Structural analysis has shown the conservation of APC15 NTH in S. cerevisiae APC/C, which is consistent with a defect in CDC20 MCC ubiquitylation caused by deleting APC15 .

  • ENA1: The ENA1 gene encodes a Na+-ATPase involved in sodium tolerance . Its expression is regulated by various factors, including calcineurin and the Rim101 pathway, in response to stress conditions like high salt and high pH .

  • Protein Complexes: Systematic curation efforts have resulted in catalogs of yeast protein complexes, such as CYC2008, which comprises 408 manually curated heteromeric protein complexes . These catalogs serve as valuable resources for studying protein-protein interactions .

Role in Oral Immunization

Saccharomyces cerevisiae can be used in oral vaccine formulations to deliver heterologous antigens safely and effectively and can elicit systemic and mucosal responses . Recombinant S. cerevisiae expressing specific proteins, such as the capsid protein VP2 of IBDV, have been explored as potential oral vaccines .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YNR025C; N3235; Putative uncharacterized protein YNR025C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YNR025C
Target Protein Sequence
MTNTKKILHNALYYVLIIIYEYVLLLVHCLRYFFEFLFLFLPLWLVFFFLMLSLNNLSRS YSSSPSSWLPVNSLSLASLFSSSFCSPSSNFLFLEPLSSELSPKVFLPLITPSGFRSSL
Uniprot No.

Target Background

Database Links

STRING: 4932.YNR025C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YNR025C and what is known about its genomic classification?

YNR025C is classified as a dubious open reading frame (ORF) in the Saccharomyces cerevisiae genome. According to the S. cerevisiae pangenome defined in Peter et al. (2018), YNR025C is classified as an "Accessory" gene of "Ancestral" origin, indicating it is not essential for basic cellular functions but has been retained through evolutionary history . Current experimental and comparative sequence data suggest it is unlikely to encode a functional protein. The most significant observation is that deletion of YNR025C reduces expression of the PIS1 gene, which encodes phosphatidylinositol synthase .

How does YNR025C fit into the broader S. cerevisiae pangenome?

YNR025C represents an interesting case study in yeast genomics as it appears in the PanORF collection with ID 6743-YNR025C . As part of the accessory genome rather than the core genome, YNR025C exemplifies the genetic diversity within S. cerevisiae strains. The presence/absence patterns across different strains can be examined through databases like ScRAPdb, which allows researchers to track the evolutionary trajectory of this ORF across both laboratory and wild strains. This evolutionary context provides insights into potential selective pressures and functional implications that might not be apparent from sequence analysis alone.

What are the recommended methods for expressing recombinant YNR025C protein?

For expressing recombinant YNR025C, a combinatorial approach using multiple expression systems is recommended:

These methodologies should be adapted based on experimental goals, with particular attention to maintaining the native conformation of this putative membrane-associated protein.

What are the best approaches for generating YNR025C knockout strains?

For generating precise YNR025C knockout strains, researchers have several methodological options:

  • CRISPR-Cas9 system:

    • Design sgRNAs targeting unique regions of YNR025C

    • Include repair templates with selection markers

    • Confirm edits via sequencing and PCR verification

    • Use markerless systems if downstream applications require marker-free strains

  • Traditional homologous recombination:

    • Construct deletion cassettes with 40-60bp homology arms

    • Use antibiotic resistance markers (KanMX, HygB) for selection

    • Verify deletions via junction PCR and phenotypic testing

  • Tetrad dissection approach:

    • Generate heterozygous diploid knockouts

    • Induce sporulation and perform tetrad analysis

    • Track segregation patterns to verify genetic modifications

When designing YNR025C knockouts, special consideration must be given to the potential effects on neighboring genes, particularly PIS1, whose expression is known to be affected by YNR025C deletion. Control strains should include those with neutral locus deletions to differentiate specific versus non-specific effects.

What methodologies can determine if YNR025C affects oxidative stress response?

To investigate YNR025C's potential role in oxidative stress response, a multi-assay approach is recommended:

  • Growth assays under oxidative stress:

    • Compare wild-type vs. YNR025C knockout growth curves in H₂O₂ (0.1-5mM)

    • Measure survival rates after acute oxidative stress exposure

    • Determine EC₅₀ values for various oxidants (H₂O₂, menadione, paraquat)

  • Molecular markers of oxidative stress:

    • Measure ROS levels using fluorescent dyes (DCF-DA, DHE)

    • Quantify lipid peroxidation products (MDA)

    • Assess protein carbonylation via western blot analysis

  • Transcriptional response analysis:

    • Perform RNA-seq comparing WT vs. knockout under basal and stress conditions

    • Focus on known oxidative stress response genes (TSA1, TSA2, TRX1, TRX2)

    • Validate key findings via RT-qPCR

  • Genetic interaction studies:

    • Create double knockouts with known oxidative stress genes

    • Analyze synthetic lethal/sick interactions

    • Perform high-throughput genetic screens to place YNR025C in functional networks

This methodological framework allows for comprehensive assessment of YNR025C's potential involvement in oxidative stress pathways, building on established protocols in oxidative stress research in yeast models .

How does YNR025C deletion impact PIS1 expression at the molecular level?

The mechanism through which YNR025C deletion reduces PIS1 expression represents a complex regulatory question requiring multi-level analysis:

  • Transcriptional regulation analysis:

    • Perform strand-specific RNA-seq to identify potential antisense transcripts

    • Map transcription start sites via 5' RACE or CAGE sequencing

    • Analyze chromatin structure changes via ATAC-seq or ChIP-seq for histone modifications

  • Promoter activity studies:

    • Create reporter constructs with PIS1 promoter driving fluorescent protein expression

    • Measure activity in WT vs. YNR025C knockout backgrounds

    • Perform promoter deletion analysis to identify regulatory elements affected

  • Epigenetic regulation:

    • Examine DNA methylation patterns in the PIS1 promoter region

    • Analyze histone modification changes at the PIS1 locus

    • Investigate potential chromatin remodeling complex recruitment

  • Trans-acting factor identification:

    • Perform RNA immunoprecipitation to identify proteins binding to PIS1 mRNA

    • Use DNA affinity purification to identify transcription factors binding the PIS1 promoter

    • Validate interactions through reporter assays and mutagenesis

This comprehensive approach can elucidate whether YNR025C affects PIS1 through cis-regulatory mechanisms (e.g., overlapping regulatory elements) or trans-acting effects (e.g., encoding a regulatory RNA), providing insights into novel regulatory mechanisms in yeast.

What is the evolutionary significance of YNR025C being classified as "Accessory" rather than "Core" in the yeast pangenome?

The evolutionary classification of YNR025C as an "Accessory" gene of "Ancestral" origin raises important questions about gene conservation and function:

  • Comparative genomic analysis:

    • Perform phylogenetic analysis across Saccharomyces species and broader fungal lineages

    • Compare sequence conservation patterns between laboratory and wild strains

    • Identify potential horizontal gene transfer events or gene conversion scenarios

  • Selection pressure analysis:

    • Calculate dN/dS ratios to determine selective constraints

    • Perform McDonald-Kreitman tests to identify adaptive evolution

    • Use ancestral sequence reconstruction to trace evolutionary trajectories

  • Population genetic approaches:

    • Analyze allele frequencies across diverse ecological niches

    • Identify potential associations with phenotypic traits or environmental adaptations

    • Calculate Tajima's D and related statistics to detect selection signatures

  • Functional impact assessment:

    • Compare phenotypic effects of YNR025C deletion across diverse strain backgrounds

    • Determine if YNR025C provides fitness advantages under specific environmental conditions

    • Investigate if YNR025C interacts with strain-specific genetic backgrounds

This evolutionary analysis can provide insights into why certain genes remain in the accessory genome despite appearing non-functional by conventional criteria, potentially revealing cryptic or condition-specific functions.

Could YNR025C function as a regulatory RNA rather than a protein-coding gene?

The classification of YNR025C as a dubious ORF raises the possibility that its biological function may be mediated through RNA rather than protein:

  • RNA structure analysis:

    • Perform in silico RNA structure prediction using algorithms like RNAfold or Mfold

    • Validate structures experimentally via SHAPE-seq or DMS-MaPseq

    • Identify potential functional RNA motifs or domains

  • RNA-protein interaction studies:

    • Use RNA pulldown assays coupled with mass spectrometry to identify binding partners

    • Perform CLIP-seq to map RNA-protein interactions in vivo

    • Validate specific interactions through mutagenesis and functional assays

  • Subcellular localization studies:

    • Use RNA FISH to determine cellular distribution of YNR025C transcripts

    • Examine association with specific cellular compartments (nucleolus, P-bodies)

    • Track RNA movement under different cellular conditions

  • Functional RNA characterization:

    • Create non-coding mutants that maintain RNA structure but disrupt protein coding

    • Test complementation with structured RNA vs. protein expression

    • Examine potential regulatory effects on gene expression through ribosome profiling

This line of investigation connects to the growing field of RNA-mediated regulation in yeast, which as noted in search result , is increasingly recognized as important in various biological processes and disease models.

What are the optimal conditions for studying YNR025C protein-protein interactions?

To effectively capture and characterize potential protein-protein interactions involving YNR025C, researchers should consider these methodological approaches:

  • In vivo interaction studies:

    MethodAdvantagesLimitationsOptimal Conditions
    Yeast two-hybridHigh-throughput capabilityHigh false positive rateUse membrane YTH systems; bait fragments to overcome membrane constraints
    Co-immunoprecipitationDetects native complexesRequires antibodies or tagsGentle cell lysis (glass beads); crosslinking may be necessary
    MYTH (Membrane YTH)Specific for membrane proteinsLimited to binary interactionsUse C-terminal bait fusions; optimize bait expression
    BioID proximity labelingCaptures transient interactionsNon-specific labelingShort labeling periods; careful control selection
  • In vitro validation:

    • Recombinant protein expression in specialized systems (insect cells, cell-free)

    • Pull-down assays with purified components

    • Biophysical methods (ITC, SPR, MST) for binding kinetics

    • Structural characterization of complexes via crystallography or cryo-EM

  • Network analysis:

    • Integration with existing protein interaction databases

    • Computational prediction of interaction interfaces

    • Functional enrichment analysis of interaction partners

    • Visualization of interaction networks to identify central nodes

For a putative membrane protein like YNR025C, special consideration must be given to maintaining native membrane environments, potentially using detergent micelles, nanodiscs, or liposomes to preserve protein structure and function during interaction studies.

How should researchers approach contradictory data regarding YNR025C function?

When facing contradictory experimental results regarding YNR025C function, a systematic troubleshooting and reconciliation approach is essential:

  • Strain-specific effects analysis:

    • Replicate key experiments across multiple strain backgrounds

    • Create isogenic strains differing only in the YNR025C locus

    • Perform genetic complementation tests with variants from different strains

  • Environmental condition variations:

    • Test function under diverse growth conditions (temperature, pH, nutrients)

    • Examine stress-specific phenotypes (oxidative, osmotic, nutrient limitation)

    • Consider interaction with media components or cultivation methods

  • Methodological reconciliation:

    • Compare detection limits and sensitivities of different assays

    • Standardize protocols across laboratories

    • Develop quantitative rather than qualitative assessment methods

  • Integrated data analysis:

    • Apply Bayesian frameworks to weigh evidence from diverse sources

    • Develop testable hypotheses that could explain apparent contradictions

    • Consider context-dependent functions that might appear contradictory when viewed in isolation

This methodical approach acknowledges that contradictions in biological data often reveal complex regulatory mechanisms or condition-specific functions rather than experimental errors.

What considerations should be made when interpreting phenotypic data from YNR025C deletion strains?

Accurate interpretation of phenotypic data from YNR025C deletion strains requires careful experimental design and consideration of potential confounding factors:

  • Genetic background effects:

    • Create deletions in multiple genetic backgrounds to assess consistency

    • Perform complementation with the wild-type gene to confirm phenotype causality

    • Consider epistatic interactions with strain-specific variants

  • Neighboring gene effects:

    • Monitor expression changes in adjacent genes, particularly PIS1

    • Create precise deletions that minimize disruption to regulatory elements

    • Design control strains with neutral locus deletions of similar size

  • Phenotypic assessment framework:

    • Use quantitative rather than qualitative phenotypic measurements

    • Apply high-dimensional phenotyping approaches (growth curves, morphology analysis)

    • Develop time-resolved measurements to capture dynamic phenotypes

  • Statistical considerations:

    • Determine appropriate sample sizes through power analysis

    • Account for both biological and technical replicates

    • Apply appropriate statistical tests with corrections for multiple comparisons

  • Data integration approach:

    • Correlate phenotypic data with molecular measurements

    • Develop predictive models to explain phenotypic variations

    • Consider systems-level effects rather than linear cause-effect relationships

This comprehensive framework ensures that phenotypic observations are robustly connected to genetic perturbations while acknowledging the complex nature of cellular systems.

How can researchers integrate YNR025C studies with broader yeast genomics and proteomics data?

Integrating YNR025C-specific studies with larger datasets requires computational approaches and database utilization:

  • Multi-omics data integration:

    • Overlay YNR025C data with transcriptome, proteome, and metabolome datasets

    • Apply network analysis to identify functional modules containing YNR025C

    • Use dimensionality reduction techniques to visualize relationships in high-dimensional data

  • Database utilization strategy:

    DatabaseRelevant InformationIntegration Approach
    SGD (Saccharomyces Genome Database)Gene annotation, interaction dataExtract interaction networks, GO term enrichment
    ScRAPdbPresence/absence patterns across strainsCorrelate with phenotypic diversity
    STRINGProtein-protein interaction predictionsPlace YNR025C in functional networks
    FungiDBCross-species comparative genomicsIdentify orthologs and evolutionary patterns
    GEO/ArrayExpressTranscriptomic datasetsMeta-analysis across experimental conditions
  • Machine learning applications:

    • Apply supervised learning to predict YNR025C function from feature sets

    • Use unsupervised clustering to identify patterns in multi-omics data

    • Develop classification models to predict phenotypic outcomes

  • Visualization and communication:

    • Create interactive visualizations of complex datasets

    • Develop standardized workflows for reproducible analysis

    • Establish data sharing practices that facilitate community contributions

This integrated approach leverages the extensive genomic and proteomic resources available for S. cerevisiae to place YNR025C studies in a broader systems biology context.

What experimental design best addresses the question of whether YNR025C has conditional functionality?

To rigorously investigate potential condition-specific functions of YNR025C, a comprehensive experimental design would include:

  • Environmental condition matrix:

    • Test across diverse carbon sources (glucose, galactose, glycerol, ethanol)

    • Vary temperature ranges (16°C, 25°C, 30°C, 37°C)

    • Include various stressors (oxidative, osmotic, pH, nutrient limitation)

    • Examine different growth phases (lag, log, diauxic shift, stationary)

  • High-resolution phenotyping:

    • Use continuous culture systems (chemostats, turbidostats)

    • Apply time-lapse microscopy for single-cell analysis

    • Implement high-throughput growth curve analysis

    • Develop reporter systems for real-time stress response monitoring

  • Genetic interaction mapping:

    • Perform synthetic genetic array analysis under multiple conditions

    • Create double mutants with stress response pathway components

    • Use inducible expression systems to control timing of genetic perturbations

  • Molecular profiling:

    • Conduct condition-specific transcriptome analysis

    • Examine protein abundance and modification changes

    • Monitor metabolic shifts using targeted metabolomics

    • Evaluate changes in cellular physiology (membrane composition, ROS levels)

  • Computational analysis framework:

    • Develop statistical methods to identify condition-specific phenotypes

    • Create predictive models of conditional functionality

    • Implement machine learning approaches to identify patterns across conditions

This experimental design acknowledges that many genes like YNR025C may have functions that are only revealed under specific environmental or genetic conditions, consistent with the observation that many accessory genes provide fitness advantages in niche environments.

How can researchers effectively study potential regulatory relationships between YNR025C and PIS1?

The reported relationship between YNR025C deletion and PIS1 expression requires specialized experimental approaches to elucidate the underlying mechanisms:

  • Chromatin architecture analysis:

    • Perform Chromosome Conformation Capture (3C/4C/Hi-C) to identify physical interactions

    • Map nucleosome positioning around both loci

    • Identify potential enhancer-promoter interactions

    • Examine topologically associating domains (TADs) that might coordinate expression

  • Transcriptional regulation studies:

    • Use nascent transcript sequencing to measure transcription rates

    • Implement CRISPR interference/activation to modulate expression

    • Apply single-molecule RNA FISH to examine co-expression patterns

    • Develop dual reporter systems to track correlated expression

  • Genetic dissection approach:

    • Create precise mutations in potential regulatory elements

    • Perform systematic deletion scanning of the intergenic region

    • Swap regulatory regions between strains with different expression patterns

    • Use synthetic constructs to test minimal regulatory elements

  • Mathematical modeling:

    • Develop dynamic models of the regulatory relationship

    • Implement stochastic simulations of gene expression

    • Create predictive models of expression under various perturbations

    • Validate models with targeted experimental measurements

This multifaceted approach can distinguish between direct regulatory relationships, shared regulatory inputs, and indirect effects, providing mechanistic understanding of how a dubious ORF like YNR025C might influence expression of an essential gene like PIS1.

What emerging technologies could advance our understanding of YNR025C function?

Several cutting-edge technologies hold promise for elucidating the functional role of YNR025C:

  • Single-cell multi-omics:

    • Single-cell RNA-seq to capture expression heterogeneity

    • Single-cell proteomics to track protein abundance variations

    • Spatial transcriptomics to map subcellular RNA localization

    • Integration of multiple single-cell modalities for comprehensive analysis

  • Advanced genome editing:

    • Base editing for precise nucleotide modifications

    • Prime editing for targeted insertions and replacements

    • Epigenetic editing to modify chromatin states without altering sequence

    • Multiplexed CRISPR screens to assess genetic interactions systematically

  • Structural biology innovations:

    • AlphaFold2 and related tools for structure prediction

    • Cryo-electron tomography for in situ structural analysis

    • Integrative structural biology combining multiple experimental modalities

    • Time-resolved structural methods to capture dynamic changes

  • Systems biology approaches:

    • Whole-cell modeling incorporating multi-scale processes

    • Causal inference methods to establish directional relationships

    • Network perturbation analysis to identify system vulnerabilities

    • Cross-species comparative systems biology to identify conserved modules

These emerging technologies can overcome current limitations in studying proteins like YNR025C, potentially revealing functions that have remained elusive using conventional approaches.

How might understanding YNR025C contribute to broader knowledge in yeast biology?

Research on YNR025C has potential implications for several fundamental areas of yeast biology:

  • Genome organization principles:

    • Insights into the functional significance of dubious ORFs

    • Understanding of regulatory mechanisms in compact genomes

    • Elucidation of evolutionary constraints on genome architecture

    • Clarification of the role of non-coding elements in gene regulation

  • Stress response mechanisms:

    • Potential discovery of novel oxidative stress response pathways

    • Understanding condition-specific gene activation mechanisms

    • Insights into cellular adaptation to environmental challenges

    • Elucidation of stress memory and priming mechanisms

  • Protein quality control systems:

    • Insights into how cells manage potentially non-functional proteins

    • Understanding of membrane protein biogenesis and quality control

    • Elucidation of mechanisms for dealing with hydrophobic proteins

    • Potential discovery of novel chaperone interactions

  • Evolutionary genomics:

    • Understanding the maintenance of accessory genes in populations

    • Insights into the transition between functional and non-functional states

    • Elucidation of the role of genetic variation in adaptive responses

    • Understanding of how new genes emerge and gain function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.