Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YOL037C (YOL037C)

Shipped with Ice Packs
In Stock

Description

Expression Systems

The recombinant YOL037C protein can be produced in various expression systems, with Escherichia coli being the most commonly documented host organism . Commercial sources indicate that the protein can also be expressed in alternative systems including yeast, mammalian cells, and insect cells depending on specific research requirements . Each expression system offers distinct advantages in terms of protein folding, post-translational modifications, and yield.

Table 1: Expression Systems for Recombinant YOL037C Production

Expression SystemAdvantagesNotable Characteristics
E. coliHigh yield, cost-effectiveLacks eukaryotic post-translational modifications
YeastNative environment, proper foldingSlower growth than bacterial systems
Mammalian cellsComplex modificationsHigher cost, lower yield
Insect cellsScalable, eukaryotic modificationsIntermediate complexity

Purification Methods and Protein Characteristics

The recombinant YOL037C protein is typically produced with affinity tags to facilitate purification. The most common format is with an N-terminal histidine tag (His-tag), which enables purification using metal affinity chromatography . Alternative fusion tags available include FLAG, MBP, GST, TrxA, Nus, Biotin, and GFP, each offering different advantages for solubility, detection, or specific experimental applications .

Commercial preparations of the recombinant protein are typically available as lyophilized powder with purity levels exceeding 90% as determined by SDS-PAGE analysis . After reconstitution in appropriate buffers, the protein requires careful handling to maintain stability, with recommendations to avoid repeated freeze-thaw cycles and to store working aliquots at 4°C for short-term use .

Functional Characterization Studies

Despite being classified as a putative uncharacterized protein, YOL037C represents an important target for functional genomics studies in yeast. While the precise function remains to be determined, structural predictions suggest it may play a role in membrane-associated processes. Research tools such as recombinant proteins and specific antibodies enable investigators to explore protein-protein interactions, subcellular localization, and potential physiological roles.

For specialized research applications, custom recombinant protein production services offer tailored solutions for YOL037C expression and purification. These services typically provide options for:

  • Choice of expression system (prokaryotic, yeast, insect, or mammalian cells)

  • Selection of fusion tags and their positioning (N-terminal or C-terminal)

  • Specific vector design and host strain selection

  • Post-purification processing including protein renaturation, endotoxin removal, filtration sterilization, and lyophilization

Custom production timelines typically range from 4-6 weeks, with some providers offering express services with accelerated delivery options .

Reconstitution Protocols

The recommended reconstitution protocol includes:

  1. Brief centrifugation of the vial prior to opening to bring contents to the bottom

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of glycerol to 5-50% final concentration for long-term storage

  4. Aliquoting into single-use volumes to avoid repeated freeze-thaw cycles

These handling procedures are essential to preserve protein structure and function for experimental applications.

Functional Characterization Opportunities

As a putative uncharacterized protein, YOL037C presents significant opportunities for fundamental discovery. Future research might leverage approaches such as:

  • Systematic interaction studies to identify binding partners

  • Localization experiments to determine subcellular distribution

  • Gene knockout or knockdown studies to observe phenotypic effects

  • Comparative genomics to identify potential homologs in other organisms

Technological Advances in Protein Characterization

Emerging technologies in structural biology, including cryo-electron microscopy and advanced computational prediction methods, may provide new insights into YOL037C structure and function. Additionally, high-throughput functional genomics approaches and metabolomic profiling could help place this protein within the broader context of yeast cellular processes and pathways.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of this product depends on various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
YOL037C; O2101; Putative uncharacterized protein YOL037C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YOL037C
Target Protein Sequence
MSKLSRKSILDEDEDVEEILPKTRGDERSTWVSSSSFVSSSLIFCKCVVTVVELDVGVAL LGIVGRVVPLYTVTLLEPEFLNLGGELSWCSMTNFCELFFYFFSFFFSKKRPNIDSK
Uniprot No.

Target Background

Database Links

STRING: 4932.YOL037C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the putative function of YOL037C in S. cerevisiae?

YOL037C is classified as a putative uncharacterized protein in S. cerevisiae. Similar to the approach used for YBR238C (described in search result ), functional characterization of YOL037C would involve multiple complementary strategies:

  • Bioinformatic analysis for protein motifs, domains, and structural predictions

  • Examination of expression patterns under various physiological conditions

  • Phenotypic characterization of deletion or overexpression strains

  • Protein localization studies using fluorescent tags

  • Interaction mapping to identify protein partners

The Saccharomyces Genome Database (SGD) provides a centralized resource for information about yeast genes, including any preliminary annotations and high-throughput study data that might provide functional clues . YOL037C may have roles in cellular processes similar to other uncharacterized yeast genes that have been subsequently characterized, such as involvement in mitochondrial function, cellular aging pathways, or stress responses.

How should researchers approach the expression and purification of recombinant YOL037C?

When choosing an expression system for YOL037C, researchers should consider:

  • Host selection:

    • S. cerevisiae offers excellent genetic tractability and a wide range of expression vectors

    • P. pastoris may provide higher yields, especially for secreted proteins

    • Each system has distinct glycosylation patterns that may affect protein function

  • Expression optimization:

    • For S. cerevisiae, consider respiratory strains for increased biomass and protein yield

    • For P. pastoris, strictly-defined bioreactor conditions may be necessary for optimal expression

    • Fusion tags can enhance solubility and facilitate purification

    • Codon optimization may improve expression levels

  • Purification strategy:

    • Affinity chromatography based on fusion tags (His, GST, etc.)

    • Ion exchange and size exclusion chromatography for higher purity

    • Protease treatments to remove tags if necessary for functional studies

As noted for other recombinant proteins, "In our laboratory, we often start with P. pastoris and if the production is not straightforward, turn to S. cerevisiae to troubleshoot, thereby benefitting from the best attributes of the two hosts" . This hybrid approach maximizes the chances of successful expression.

What phenotypic analyses are most informative for characterizing YOL037C function?

Systematic phenotypic analysis of YOL037C should include:

  • Growth phenotypes:

    • Growth rate measurements in different carbon sources and media compositions

    • Stress tolerance assays (oxidative, temperature, osmotic, nutrient limitation)

    • Cell morphology and cell cycle progression analysis

  • Lifespan measurements:

    • Chronological lifespan (CLS) to assess post-mitotic survival

    • Replicative lifespan (RLS) to measure division capacity

    • Comparison with known aging pathway mutants

  • Cellular pathways:

    • Relationship to TORC1 signaling through rapamycin sensitivity

    • Mitochondrial function assessment (similar to analysis of YBR238C)

    • Metabolic profiling under different growth conditions

For YBR238C, researchers found it was "the only one among the latter that increases both CLS and RLS upon deletion and that is downregulated by rapamycin" . Similar comprehensive phenotypic analysis of YOL037C could reveal its involvement in cellular aging or other fundamental processes.

Phenotypic ParameterWild-typeYOL037C DeletionYOL037C Overexpression
Growth in glucoseBaselineTo be determinedTo be determined
Growth in glycerolBaselineTo be determinedTo be determined
Oxidative stress resistanceBaselineTo be determinedTo be determined
Chronological lifespanBaselineTo be determinedTo be determined
Replicative lifespanBaselineTo be determinedTo be determined
Rapamycin sensitivityBaselineTo be determinedTo be determined

What molecular biology techniques are most effective for studying YOL037C?

Effective molecular characterization of YOL037C requires multiple approaches:

  • Gene manipulation:

    • PCR-based gene deletion using selectable markers

    • CRISPR-Cas9 for marker-free or conditional modifications

    • Epitope tagging for localization and interaction studies

    • Promoter replacement for controlled expression

  • Expression analysis:

    • RT-qPCR for specific conditions or time-courses

    • RNA-seq for genome-wide expression context

    • Promoter reporter constructs to study regulation

  • Protein analysis:

    • Western blotting for expression and modification detection

    • Mass spectrometry for post-translational modifications

    • Immunoprecipitation for interaction partners

S. cerevisiae offers numerous advantages for these molecular approaches, including "a complete set of single, non-essential gene deletion strains (EUROSCARF) as well as a strain collection of tetracycline-regulated essential genes (Open Biosystems)" , which can serve as valuable controls and comparison points.

How can researchers determine the subcellular localization of YOL037C?

To determine YOL037C subcellular localization:

  • Fluorescent protein fusion approaches:

    • C-terminal and N-terminal GFP fusions to assess proper localization

    • Time-lapse microscopy to capture dynamic localization changes

    • Co-localization with organelle markers

  • Biochemical fractionation:

    • Differential centrifugation to separate cellular compartments

    • Density gradient separation for membrane-associated proteins

    • Western blot analysis of fractions using epitope-tagged YOL037C

  • Immunolocalization:

    • Generation of specific antibodies against YOL037C

    • Immunofluorescence microscopy with fixed cells

    • Immunogold electron microscopy for higher resolution

Methods similar to those used for YBR238C, which was found to have mitochondrial localization , would be appropriate. The Huh et al. (2003) GFP fusion protein localization database provides a systematic approach that has been successfully applied to many yeast proteins.

What high-throughput methods can identify potential functional relationships for YOL037C?

Several high-throughput approaches can reveal functional insights:

  • Genetic interaction mapping:

    • Synthetic genetic array (SGA) analysis to identify genetic interactions

    • Suppressor screens to identify functional relationships

    • Chemical-genetic profiling to assess pathway involvement

  • Physical interaction analysis:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Yeast two-hybrid screening for binary interactions

    • Proximity-dependent biotin identification (BioID) for near-neighbors

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Network analysis to place YOL037C in cellular pathways

    • Comparison with datasets for characterized genes

These approaches have proven valuable for characterizing uncharacterized genes in S. cerevisiae, as demonstrated by the identification of YBR238C as "an effector of TORC1 that modulates mitochondrial function" .

How can comparative genomics be used to predict YOL037C function?

Comparative genomics approaches include:

  • Homology analysis:

    • BLAST searches against fungal and other eukaryotic genomes

    • Identification of conserved domains and motifs

    • Phylogenetic profiling across species

  • Evolutionary analysis:

    • Calculation of selection pressures (dN/dS ratios)

    • Identification of co-evolving gene families

    • Assessment of gene duplication and divergence patterns

  • Cross-species functional inference:

    • Analysis of functional data from homologs in other organisms

    • Complementation studies with homologs

    • Identification of conserved interaction networks

As demonstrated in the analysis of S. cerevisiae as a model organism, such comparative approaches can "identify the pathways and processes for which S. cerevisiae is predicted to be a good model to extrapolate from" , and conversely, can provide evolutionary context for specific genes like YOL037C.

What transcriptomic analyses would be most revealing for understanding YOL037C function?

Comprehensive transcriptomic analysis should include:

  • Differential expression analysis:

    • Comparison of wild-type vs. YOL037C deletion strains

    • Response to various stresses and growth conditions

    • Time-course analysis during growth phases or developmental transitions

  • Co-expression network analysis:

    • Identification of genes with similar expression patterns

    • Correlation with known functional modules

    • Construction of gene regulatory networks

  • Transcription factor binding analysis:

    • ChIP-seq to identify transcription factors regulating YOL037C

    • Analysis of YOL037C promoter for regulatory elements

    • Perturbation studies with transcription factor mutants

Similar to the approach used for YBR238C, researchers should determine if YOL037C is regulated by key signaling pathways such as TORC1, which was found to transcriptionally upregulate YBR238C . This information can place YOL037C within specific regulatory networks.

How can mitochondrial function be assessed in relation to YOL037C activity?

To investigate potential mitochondrial roles:

  • Respiratory capacity measurements:

    • Oxygen consumption rates in intact cells and isolated mitochondria

    • Growth on non-fermentable carbon sources

    • Activity of respiratory chain complexes

  • Mitochondrial morphology and dynamics:

    • Fluorescence microscopy of mitochondrial networks

    • Analysis of fusion/fission events

    • Electron microscopy for ultrastructural changes

  • Mitochondrial gene expression:

    • Analysis of mitochondrial DNA maintenance

    • Expression of nuclear-encoded mitochondrial proteins

    • Mitochondrial translation efficiency

For YBR238C, researchers found it "negatively regulates mitochondrial function, largely via HAP4- and RMD9-dependent mechanisms" . Similar mechanistic studies could reveal whether YOL037C has comparable impacts on mitochondrial biogenesis or function.

How can systems biology approaches integrate YOL037C into cellular networks?

Systems biology integration requires:

  • Network reconstruction:

    • Integration of protein-protein interaction data

    • Metabolic network mapping if metabolism-related

    • Signaling pathway integration

  • Dynamic modeling:

    • Quantitative models of relevant pathways

    • Integration of time-resolved data

    • Perturbation analysis to validate model predictions

  • Multi-scale analysis:

    • Linking molecular interactions to cellular phenotypes

    • Community detection in biological networks

    • Identification of network motifs and functional modules

These approaches can place YOL037C within its biological context, similar to how researchers integrated YBR238C into a "feedback loop of the interaction of TORC1 with mitochondria that affect cellular aging" .

What considerations are important when using YOL037C as a model for studying uncharacterized proteins in higher eukaryotes?

Key considerations include:

  • Evolutionary conservation:

    • Identification of homologs in other species

    • Assessment of functional domain conservation

    • Evaluation of pathway conservation across species

  • Model validation:

    • Cross-species complementation studies

    • Comparative phenotypic analysis

    • Interaction conservation assessment

  • Translational relevance:

    • Connection to human disease-related pathways

    • Potential as a therapeutic target model

    • Applicability to fundamental biological questions

As noted in the analysis of S. cerevisiae as a model organism, "animals in general and Homo sapiens in particular are some of the non-fungal organisms for which S. cerevisiae is likely to be a good model in which to study a significant fraction of common biological processes" . This framework can help determine which aspects of YOL037C function might be most relevant to human biology.

How can machine learning and computational approaches enhance functional prediction for YOL037C?

Advanced computational approaches include:

  • Supervised learning methods:

    • Classification of proteins into functional categories

    • Prediction of Gene Ontology terms

    • Identification of functional domains and motifs

  • Unsupervised learning:

    • Clustering of proteins with similar features

    • Pattern recognition in sequence and structure data

    • Dimensionality reduction for multi-omics data integration

  • Structural bioinformatics:

    • Protein structure prediction (e.g., using AlphaFold)

    • Molecular dynamics simulations

    • Binding site prediction and virtual screening

Similar approaches have been successful for other uncharacterized yeast proteins, as seen with YBR238C where sequence architecture analysis with ANNOTATOR and HHpred revealed "an intrinsically unstructured region" and "a pentatricopeptide repeat region" , providing clues to function.

What are the current challenges in studying uncharacterized proteins like YOL037C?

Major challenges include:

  • Technical limitations:

    • Difficulty expressing proteins with unknown functions

    • Lack of specific assays for functional testing

    • Potential redundancy masking phenotypes

  • Data interpretation:

    • Complex pleiotropy of genetic perturbations

    • Difficulty distinguishing direct from indirect effects

    • Integration of conflicting or noisy data

  • Functional validation:

    • Need for multiple lines of evidence

    • Difficulty confirming computational predictions

    • Establishing physiological relevance of molecular functions

These challenges necessitate integrative approaches, as demonstrated in the study of YBR238C, which combined "transcriptomics and biochemical experiments" along with "chemical genetics and metabolic analyses" to establish its function.

How should researchers design experiments to determine if YOL037C affects cellular aging?

To investigate aging effects:

  • Lifespan measurements:

    • Chronological lifespan assays (survival in stationary phase)

    • Replicative lifespan determination (counting daughter cells)

    • Microfluidic single-cell aging analysis for higher throughput

  • Aging pathway analysis:

    • Epistasis analysis with known aging pathway components

    • Response to caloric restriction and rapamycin

    • Mitochondrial function assessment during aging

  • Molecular markers of aging:

    • Protein aggregation quantification

    • Oxidative damage measurements

    • Gene expression changes associated with aging

For YBR238C, researchers systematically compared "genesets involved in regulating the lifespan" and found it "increases both CLS and RLS upon deletion" . Similar systematic approaches can reveal whether YOL037C impacts aging through conserved or novel mechanisms.

ExperimentMethodologyExpected Outcome
Chronological lifespanCulture viability over time in stationary phaseDetermine if YOL037C deletion/overexpression affects post-mitotic survival
Replicative lifespanMicromanipulation of mother cellsDetermine if YOL037C deletion/overexpression affects division capacity
Rapamycin responseGrowth and lifespan with/without rapamycinAssess TORC1 pathway involvement
Mitochondrial functionOxygen consumption, membrane potentialDetermine effect on respiratory capacity
Stress resistanceSurvival after oxidative, heat stressAssess general stress response role

What experimental controls are critical when characterizing YOL037C?

Essential controls include:

  • Strain background controls:

    • Wild-type parental strain

    • Empty vector controls for expression studies

    • Unrelated gene deletions/overexpressions as specificity controls

  • Functional validation controls:

    • Complementation with wild-type YOL037C

    • Structure-function analysis with mutant variants

    • Dose-dependent effects through regulated expression

  • Specificity controls:

    • Paralogs or related genes

    • Known components of suspected pathways

    • Tissue/condition-specific expression analysis

How can researchers determine whether YOL037C has paralogs that might provide functional redundancy?

To identify and analyze paralogs:

  • Sequence similarity searches:

    • BLAST against the S. cerevisiae genome

    • Profile-based searches for more distant relationships

    • Structural similarity predictions

  • Evolutionary analysis:

    • Determination of duplication timing and mechanisms

    • Identification of shared synteny regions

    • Analysis of selection pressures on duplicate pairs

  • Functional relationship assessment:

    • Construction of double/multiple mutants

    • Cross-complementation studies

    • Comparison of expression patterns and regulation

The relationship between YBR238C and its paralog RMD9 provides a valuable example, as they have "similar globular segment[s]" but opposite functional effects, illustrating how paralogs can evolve divergent functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.